Homologs in group_2488

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01530 FBDBKF_01530 100.0 Morganella morganii S1 iclR DNA-binding transcriptional regulator, IclR family
EHELCC_00015 EHELCC_00015 100.0 Morganella morganii S2 iclR DNA-binding transcriptional regulator, IclR family
NLDBIP_03445 NLDBIP_03445 100.0 Morganella morganii S4 iclR DNA-binding transcriptional regulator, IclR family
HKOGLL_02085 HKOGLL_02085 100.0 Morganella morganii S5 iclR DNA-binding transcriptional regulator, IclR family
PMI_RS13600 PMI_RS13600 27.2 Proteus mirabilis HI4320 iclR glyoxylate bypass operon transcriptional repressor IclR

Distribution of the homologs in the orthogroup group_2488

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2488

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P16528 2.76e-20 90 23 3 238 1 iclR Transcriptional repressor IclR Escherichia coli (strain K12)
A1B8Z4 3.12e-19 87 25 4 235 1 bhcR HTH-type transcriptional regulator BhcR Paracoccus denitrificans (strain Pd 1222)
P76268 4.61e-19 87 25 4 243 1 kdgR HTH-type transcriptional regulator KdgR Escherichia coli (strain K12)
P71977 9.67e-19 85 25 2 243 1 Rv1719 HTH-type transcriptional regulator Rv1719 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P37728 2.55e-18 85 24 3 242 1 kdgR HTH-type transcriptional regulator KdgR Dickeya chrysanthemi
P17430 1.17e-17 83 23 3 238 4 iclR Acetate operon repressor Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P77300 3.93e-17 81 26 7 255 1 xynR HTH-type transcriptional regulator XynR Escherichia coli (strain K12)
Q0K846 9.29e-13 69 24 3 220 4 sauR Probable transcriptional regulator SauR Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
D4GP42 8.46e-09 58 27 6 209 1 xacR HTH-type transcriptional regulator XacR Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q9R9U0 1.54e-08 57 22 4 239 1 srpS HTH-type transcriptional regulator SrpS Pseudomonas putida
O83046 1.66e-08 57 24 7 241 2 pcaU Pca operon regulatory protein Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q8ZR86 1.12e-07 55 21 3 193 3 allR HTH-type transcriptional repressor AllR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PCF5 1.12e-07 55 21 3 193 3 allR HTH-type transcriptional repressor AllR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57S48 1.12e-07 55 21 3 193 3 allR HTH-type transcriptional repressor AllR Salmonella choleraesuis (strain SC-B67)
Q1RF28 1.39e-07 54 20 2 191 3 allR HTH-type transcriptional repressor AllR Escherichia coli (strain UTI89 / UPEC)
A1A8H2 1.39e-07 54 20 2 191 3 allR HTH-type transcriptional repressor AllR Escherichia coli O1:K1 / APEC
P0ACN4 1.54e-07 54 20 2 191 1 allR HTH-type transcriptional repressor AllR Escherichia coli (strain K12)
P0ACN5 1.54e-07 54 20 2 191 3 allR HTH-type transcriptional repressor AllR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKD5 1.54e-07 54 20 2 191 3 allR HTH-type transcriptional repressor AllR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P0ACN6 1.54e-07 54 20 2 191 3 allR HTH-type transcriptional repressor AllR Escherichia coli O157:H7
Q8Z8R2 1.67e-07 54 21 3 193 3 allR HTH-type transcriptional repressor AllR Salmonella typhi
P77732 2.4e-07 53 22 6 231 1 rhmR Uncharacterized HTH-type transcriptional regulator RhmR Escherichia coli (strain K12)
Q93PU6 2.54e-07 53 22 4 239 1 ttgV HTH-type transcriptional regulator TtgV Pseudomonas putida (strain DOT-T1E)
Q765S0 9.2e-07 52 21 3 188 3 allR HTH-type transcriptional repressor AllR Klebsiella pneumoniae
P39360 1.29e-06 52 23 8 249 4 yjhI Uncharacterized HTH-type transcriptional regulator YjhI Escherichia coli (strain K12)
P44996 1.46e-06 51 23 4 247 4 HI_1032 Uncharacterized HTH-type transcriptional regulator HI_1032 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P22866 1.84e-06 51 21 2 215 2 gylR Glycerol operon regulatory protein Streptomyces griseus
P15360 2.53e-06 50 22 3 212 4 gylR Glycerol operon regulatory protein Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q52154 1.66e-05 48 21 7 244 2 pcaR Pca regulon regulatory protein Pseudomonas putida

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_04960
Feature type CDS
Gene iclR
Product DNA-binding transcriptional regulator, IclR family
Location 284859 - 285632 (strand: 1)
Length 774 (nucleotides) / 257 (amino acids)

Contig

Accession ZDB_361
Length 286024 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2488
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01614 Bacterial transcriptional regulator
PF09339 IclR helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1414 Transcription (K) K DNA-binding transcriptional regulator, IclR family

Protein Sequence

MSTEHMPTIRVLEVLSVLAAENTGISLTQLAGKTGILKGTLYPILKTLAERRYINYDENTQLYFLGIACSILSRSFFEKSYWLKMVHREMNNIVNECNEVCQMGILDGPDVLYIDKVQSAQKVQLVSNIGTRLPAVYSALGKAMICHYSDDDILRLYPDGFTPLTKYSITTIAELRQQLEDVKINHYATDNREINEETCCYAVSLRQRNKIVAAISVSVPTFRSNDEKNNQIISVLLSSRERIEQELNTLQDVEFYQ

Flanking regions ( +/- flanking 50bp)

CGGGGCTTTGTACCTAGAATAACGGCATAAACTGTCAAGGAGGTGAATTGATGTCAACGGAGCATATGCCGACAATACGGGTGTTAGAGGTACTCAGTGTTCTGGCGGCAGAAAACACCGGGATTTCCCTCACGCAGCTGGCCGGAAAAACCGGCATATTAAAAGGCACGCTCTACCCGATTCTCAAAACGCTGGCAGAACGCCGTTATATTAATTATGACGAAAACACCCAGCTTTATTTTCTGGGTATCGCCTGCTCCATTCTTTCCCGTTCATTCTTTGAAAAATCGTACTGGCTGAAAATGGTGCACCGCGAGATGAATAATATTGTCAACGAGTGCAATGAAGTGTGCCAGATGGGTATATTAGATGGCCCGGATGTGCTGTATATCGATAAAGTGCAGTCTGCCCAGAAAGTTCAGTTAGTCTCCAATATCGGCACCCGCTTACCGGCAGTTTATTCCGCATTAGGCAAAGCGATGATATGCCATTACAGCGATGATGATATTCTCCGTTTATATCCTGACGGATTTACCCCGCTGACAAAATACAGTATCACCACCATTGCGGAATTACGTCAGCAGCTGGAAGATGTCAAAATAAATCATTACGCCACTGACAACCGGGAAATAAACGAAGAAACCTGCTGCTATGCCGTTTCATTACGTCAGCGCAATAAAATTGTCGCCGCTATCAGTGTCTCCGTCCCGACATTCCGCAGTAATGATGAAAAAAACAACCAGATTATCAGTGTATTACTCAGCAGCCGCGAACGTATTGAGCAGGAATTGAACACATTGCAGGATGTGGAGTTTTATCAGTAAAGATTAATATCAAAAAGCCGCTAAGCGGCTTTCATCATCAATAATATTAG