Homologs in group_39

Help

13 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00755 FBDBKF_00755 100.0 Morganella morganii S1 - Lipoprotein
FBDBKF_01755 FBDBKF_01755 39.6 Morganella morganii S1 - DUF5339 domain-containing protein
EHELCC_00790 EHELCC_00790 100.0 Morganella morganii S2 - Lipoprotein
EHELCC_02225 EHELCC_02225 39.6 Morganella morganii S2 - DUF5339 domain-containing protein
NLDBIP_01235 NLDBIP_01235 39.6 Morganella morganii S4 - DUF5339 domain-containing protein
NLDBIP_02670 NLDBIP_02670 100.0 Morganella morganii S4 - Lipoprotein
LHKJJB_00800 LHKJJB_00800 39.6 Morganella morganii S3 - DUF5339 domain-containing protein
HKOGLL_00840 HKOGLL_00840 39.6 Morganella morganii S5 - DUF5339 domain-containing protein
HKOGLL_02860 HKOGLL_02860 100.0 Morganella morganii S5 - Lipoprotein
F4V73_RS04085 F4V73_RS04085 43.8 Morganella psychrotolerans - DUF5339 domain-containing protein
F4V73_RS06755 F4V73_RS06755 85.4 Morganella psychrotolerans - DUF5339 domain-containing protein
PMI_RS04815 PMI_RS04815 42.4 Proteus mirabilis HI4320 - DUF5339 domain-containing protein
PMI_RS14080 PMI_RS14080 23.7 Proteus mirabilis HI4320 - DUF5339 family protein

Distribution of the homologs in the orthogroup group_39

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_39

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_04185
Feature type CDS
Gene -
Product Lipoprotein
Location 116435 - 116758 (strand: 1)
Length 324 (nucleotides) / 107 (amino acids)

Contig

Accession ZDB_361
Length 286024 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_39
Orthogroup size 14
N. genomes 7

Actions

Genomic region

Domains

PF17274 Family of unknown function (DUF5339)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1464 Inorganic ion transport and metabolism (P) P ABC-type metal ion transport system, periplasmic component/surface antigen

Protein Sequence

MKKTILACSLGLMALALTACSGEEKSASSVPGATETCNKYFAEVDDLVKKATEKAGDNEAAKAQLEPMLKQFDEAKKQIATLPKEQQDAACKAGSDAMAQIKQAMGI

Flanking regions ( +/- flanking 50bp)

TTTATAATTTGCCACTGTTTTATTCCACGATAATCACAAGGTACTCACTGATGAAAAAAACAATTTTAGCCTGCTCTCTGGGTTTAATGGCTCTGGCTCTGACTGCATGTTCCGGCGAAGAAAAATCAGCATCATCCGTTCCGGGTGCAACTGAAACCTGTAACAAATACTTTGCTGAAGTCGATGATTTAGTGAAGAAAGCAACTGAAAAAGCCGGTGACAACGAAGCAGCCAAAGCACAGTTAGAACCAATGCTGAAACAGTTTGACGAAGCGAAAAAACAAATCGCAACACTGCCGAAAGAGCAGCAGGACGCAGCATGCAAAGCAGGCAGCGACGCAATGGCTCAGATTAAGCAGGCAATGGGTATCTGATTTCCGTTGTGACAGACTGACCGTTCTGAACCGCGGCATCCCTGCTGCGG