Homologs in group_43

Help

12 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00755 FBDBKF_00755 85.4 Morganella morganii S1 - Lipoprotein
FBDBKF_01755 FBDBKF_01755 38.0 Morganella morganii S1 - DUF5339 domain-containing protein
EHELCC_00790 EHELCC_00790 85.4 Morganella morganii S2 - Lipoprotein
EHELCC_02225 EHELCC_02225 38.0 Morganella morganii S2 - DUF5339 domain-containing protein
NLDBIP_01235 NLDBIP_01235 38.0 Morganella morganii S4 - DUF5339 domain-containing protein
NLDBIP_02670 NLDBIP_02670 85.4 Morganella morganii S4 - Lipoprotein
LHKJJB_00800 LHKJJB_00800 38.0 Morganella morganii S3 - DUF5339 domain-containing protein
LHKJJB_04185 LHKJJB_04185 85.4 Morganella morganii S3 - Lipoprotein
HKOGLL_00840 HKOGLL_00840 38.0 Morganella morganii S5 - DUF5339 domain-containing protein
HKOGLL_02860 HKOGLL_02860 85.4 Morganella morganii S5 - Lipoprotein
F4V73_RS04085 F4V73_RS04085 42.4 Morganella psychrotolerans - DUF5339 domain-containing protein
PMI_RS04815 PMI_RS04815 44.6 Proteus mirabilis HI4320 - DUF5339 domain-containing protein

Distribution of the homologs in the orthogroup group_43

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_43

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06755
Feature type CDS
Gene -
Product DUF5339 domain-containing protein
Location 1402882 - 1403193 (strand: 1)
Length 312 (nucleotides) / 103 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_43
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Domains

PF17274 Family of unknown function (DUF5339)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4607 Inorganic ion transport and metabolism (P) P ABC-type enterochelin transport system, periplasmic component

Protein Sequence

MKKTILACSLGLMALALTACSGEEKTASAVPGATETCNKYFSEVDALMKKASENEAAKAQLEPMMKQYDDAKKQIAAMPKDQQDAACKAGSEALAQVKQAMGI

Flanking regions ( +/- flanking 50bp)

TAATTCCGGACGATTTATTCCACGATAATCACAAGCAAGGTACTCACTACATGAAAAAAACAATCTTAGCCTGCTCTCTGGGTTTGATGGCTCTGGCACTTACCGCATGTTCCGGCGAAGAAAAAACAGCATCAGCCGTTCCGGGCGCTACTGAAACCTGTAACAAATACTTCTCTGAAGTTGATGCTTTAATGAAAAAAGCCAGCGAAAACGAAGCAGCTAAAGCTCAGTTAGAGCCGATGATGAAGCAGTACGATGATGCTAAAAAGCAAATCGCTGCAATGCCTAAAGATCAGCAGGATGCTGCATGTAAAGCAGGTAGCGAAGCACTGGCTCAGGTTAAGCAGGCAATGGGTATCTAATATCCTTCCCGTGTGGAAAGATATTTCACAACCGCAGTATCCTTACTGCG