Homologs in group_200

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02845 FBDBKF_02845 100.0 Morganella morganii S1 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
EHELCC_03315 EHELCC_03315 100.0 Morganella morganii S2 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
NLDBIP_00145 NLDBIP_00145 100.0 Morganella morganii S4 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
HKOGLL_01930 HKOGLL_01930 100.0 Morganella morganii S5 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
F4V73_RS05285 F4V73_RS05285 85.4 Morganella psychrotolerans - ABC transporter ATP-binding protein
F4V73_RS17925 F4V73_RS17925 25.8 Morganella psychrotolerans - AAA family ATPase
PMI_RS14635 PMI_RS14635 34.9 Proteus mirabilis HI4320 - ATP-binding cassette domain-containing protein

Distribution of the homologs in the orthogroup group_200

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_200

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q81V82 4.98e-50 167 35 3 227 1 fpuD Petrobactin import ATP-binding protein FpuD Bacillus anthracis
P07821 1.2e-46 159 34 3 229 1 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Escherichia coli (strain K12)
O32188 5.12e-46 157 33 3 227 1 yusV Probable siderophore transport system ATP-binding protein YusV Bacillus subtilis (strain 168)
P15031 2.11e-45 155 35 3 228 1 fecE Fe(3+) dicitrate transport ATP-binding protein FecE Escherichia coli (strain K12)
O34510 1.31e-44 153 32 5 242 3 yfmF Fe(3+)-citrate import ATP-binding protein YfmF Bacillus subtilis (strain 168)
Q47087 8.92e-44 151 31 3 229 3 cbrD Achromobactin transport ATP-binding protein CbrD Dickeya dadantii (strain 3937)
P23878 3.73e-42 147 31 4 235 1 fepC Ferric enterobactin transport ATP-binding protein FepC Escherichia coli (strain K12)
Q9HQ18 1.27e-40 146 35 6 244 1 btuD Cobalamin import ATP-binding protein BtuD Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G4 1.27e-40 146 35 6 244 3 btuD Cobalamin import ATP-binding protein BtuD Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P49938 1.3e-40 143 30 3 228 3 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Bacillus subtilis (strain 168)
Q2RZ08 3.07e-40 142 33 7 245 3 hmuV Hemin import ATP-binding protein HmuV Salinibacter ruber (strain DSM 13855 / M31)
Q81LM1 7.51e-40 141 32 3 226 1 fpuC Petrobactin import ATP-binding protein FpuC Bacillus anthracis
P94420 4.45e-39 139 29 6 245 1 yclP Petrobactin import ATP-binding protein YclP Bacillus subtilis (strain 168)
Q1I4Q5 7.3e-39 138 32 5 237 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas entomophila (strain L48)
Q4K5Z7 9.04e-39 138 32 5 231 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q12R52 1.44e-38 137 33 8 240 3 hmuV Hemin import ATP-binding protein HmuV Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q32AY3 2.62e-38 137 32 6 231 3 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae serotype 1 (strain Sd197)
Q8FCJ1 3.46e-38 137 32 6 231 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBU8 3.46e-38 137 32 6 231 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q57554 3.66e-38 136 37 7 222 3 MJ0089 Uncharacterized ABC transporter ATP-binding protein MJ0089 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q1R597 5.78e-38 136 32 6 231 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli (strain UTI89 / UPEC)
Q88DY1 7.6e-38 135 33 5 233 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
O70014 1.17e-37 135 32 6 231 1 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae
Q8X5N2 1.36e-37 135 32 6 231 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O157:H7
Q3K6R9 1.91e-37 134 33 5 231 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain Pf0-1)
Q7NN36 7.12e-37 134 34 5 234 3 hmuV Hemin import ATP-binding protein HmuV Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q81XB3 2.51e-36 132 36 6 225 1 fatE Petrobactin import ATP-binding protein FatE Bacillus anthracis
Q1LC89 3.92e-36 131 32 7 239 3 hmuV Hemin import ATP-binding protein HmuV Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q7W025 7.69e-36 130 33 7 236 3 hmuV Hemin import ATP-binding protein HmuV Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
O68877 2.51e-35 129 32 5 231 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02FW7 2.51e-35 129 32 5 231 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas aeruginosa (strain UCBPP-PA14)
Q7WEH6 3.14e-35 129 33 7 236 3 hmuV Hemin import ATP-binding protein HmuV Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q93SH7 9.56e-35 128 30 6 235 3 hmuV Hemin import ATP-binding protein HmuV Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q6LQC0 1.08e-34 128 31 4 225 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium profundum (strain SS9)
Q2J3T0 2.13e-34 127 32 6 235 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain HaA2)
Q3ICT8 2.15e-34 127 32 6 231 3 hmuV Hemin import ATP-binding protein HmuV Pseudoalteromonas translucida (strain TAC 125)
Q6N7Y6 4.56e-34 126 36 8 233 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q28QF9 4.78e-34 126 32 5 241 3 hmuV Hemin import ATP-binding protein HmuV Jannaschia sp. (strain CCS1)
Q8L1U3 5.04e-34 126 32 7 242 1 hmuV Hemin import ATP-binding protein HmuV Bordetella avium
Q2KUC0 5.04e-34 126 32 7 242 3 hmuV Hemin import ATP-binding protein HmuV Bordetella avium (strain 197N)
Q138A9 7.79e-34 125 32 5 235 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB5)
Q70GD4 1.17e-33 125 31 6 232 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damsela subsp. piscicida
Q7W359 1.18e-33 125 32 7 236 3 hmuV Hemin import ATP-binding protein HmuV Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q0SIB7 1.67e-33 125 33 5 222 3 hmuV Hemin import ATP-binding protein HmuV Rhodococcus jostii (strain RHA1)
Q659V4 2.64e-33 124 31 6 232 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damselae subsp. damselae
Q217B2 3.55e-33 124 30 5 245 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB18)
Q93SS1 4.51e-33 123 28 4 243 3 hmuV Hemin import ATP-binding protein HmuV Plesiomonas shigelloides
Q5E5I1 5.6e-33 123 32 5 224 3 hmuV Hemin import ATP-binding protein HmuV Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8EB59 1.3e-32 122 30 7 246 3 hmuV Hemin import ATP-binding protein HmuV Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q92N13 2.19e-32 122 32 6 241 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium meliloti (strain 1021)
Q8UCM5 2.28e-32 122 31 5 230 3 hmuV Hemin import ATP-binding protein HmuV Agrobacterium fabrum (strain C58 / ATCC 33970)
Q7MFA1 2.49e-32 121 29 5 226 3 hmuV Hemin import ATP-binding protein HmuV Vibrio vulnificus (strain YJ016)
Q7N3S7 2.96e-32 121 31 8 246 3 hmuV Hemin import ATP-binding protein HmuV Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q84EY8 5.34e-32 120 30 5 230 3 hmuV Hemin import ATP-binding protein HmuV Enterobacter cloacae
Q160G4 5.81e-32 120 34 5 238 3 hmuV Hemin import ATP-binding protein HmuV Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q8D3S8 7.82e-32 120 29 5 226 3 hmuV Hemin import ATP-binding protein HmuV Vibrio vulnificus (strain CMCP6)
Q2SB47 7.99e-32 120 29 6 235 3 hmuV Hemin import ATP-binding protein HmuV Hahella chejuensis (strain KCTC 2396)
Q47MA5 1.41e-31 120 35 4 227 3 hmuV Hemin import ATP-binding protein HmuV Thermobifida fusca (strain YX)
Q9RKQ4 1.47e-31 120 31 4 233 3 hmuV Hemin import ATP-binding protein HmuV Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q07LU3 1.58e-31 119 30 6 241 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisA53)
Q2NSR0 1.75e-31 119 30 9 238 3 hmuV Hemin import ATP-binding protein HmuV Sodalis glossinidius (strain morsitans)
Q6D645 3.9e-31 118 30 7 230 3 hmuV Hemin import ATP-binding protein HmuV Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q66FK0 4.52e-31 118 28 7 250 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CE65 4.52e-31 118 28 7 250 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Nepal516)
Q56993 4.52e-31 118 28 7 250 1 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis
Q1C0Q8 4.52e-31 118 28 7 250 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Antiqua)
Q31J97 4.81e-31 118 31 8 238 3 hmuV Hemin import ATP-binding protein HmuV Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q58283 6.51e-31 119 29 5 222 3 MJ0873 Uncharacterized ABC transporter ATP-binding protein MJ0873 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q70YG7 8.11e-31 117 29 5 229 1 hmuV Hemin import ATP-binding protein HmuV Vibrio anguillarum (strain ATCC 68554 / 775)
Q1DCP5 2.79e-30 116 29 5 233 3 hmuV Hemin import ATP-binding protein HmuV Myxococcus xanthus (strain DK1622)
Q3IM24 4.08e-30 116 33 7 217 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q11ID5 7.79e-30 115 30 6 254 3 hmuV Hemin import ATP-binding protein HmuV Chelativorans sp. (strain BNC1)
Q20Y31 1.35e-29 114 32 7 228 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain BisB18)
Q3SQ65 1.47e-29 114 30 6 241 3 hmuV Hemin import ATP-binding protein HmuV Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q1GJU0 1.63e-29 114 29 4 244 3 hmuV Hemin import ATP-binding protein HmuV Ruegeria sp. (strain TM1040)
Q6WB63 1.97e-29 114 30 6 230 3 phnC Phosphonates import ATP-binding protein PhnC Alcaligenes faecalis
P74981 2.25e-29 114 27 6 247 1 hmuV Hemin import ATP-binding protein HmuV Yersinia enterocolitica
Q5YVL8 2.97e-29 114 30 4 220 3 hmuV Hemin import ATP-binding protein HmuV Nocardia farcinica (strain IFM 10152)
Q9KL34 3.45e-29 113 29 5 231 3 hmuV Hemin import ATP-binding protein HmuV Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q89C51 3.48e-29 113 32 7 231 3 phnC Phosphonates import ATP-binding protein PhnC Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q72AQ6 4.38e-29 113 31 6 233 3 phnC Phosphonates import ATP-binding protein PhnC Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q2IYS5 5.65e-29 113 29 7 231 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain HaA2)
Q1J255 1.13e-28 112 29 7 251 3 hmuV Hemin import ATP-binding protein HmuV Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q7M8M4 2.1e-28 111 30 6 230 3 phnC Phosphonates import ATP-binding protein PhnC Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q6G098 2.46e-28 111 31 6 248 3 hmuV Hemin import ATP-binding protein HmuV Bartonella quintana (strain Toulouse)
Q87J32 6.14e-28 110 27 5 227 3 hmuV Hemin import ATP-binding protein HmuV Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q132E8 6.55e-28 110 32 8 226 3 phnC Phosphonates import ATP-binding protein PhnC Rhodopseudomonas palustris (strain BisB5)
Q07PZ0 8.76e-28 110 29 7 231 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisA53)
Q5QXD0 1.2e-27 109 27 5 236 3 hmuV Hemin import ATP-binding protein HmuV Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
O34631 1.56e-27 112 31 5 229 3 yvrA Uncharacterized ABC transporter ATP-binding protein YvrA Bacillus subtilis (strain 168)
Q1MCZ1 1.62e-27 109 30 4 238 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q6G475 1.8e-27 109 31 7 241 3 hmuV Hemin import ATP-binding protein HmuV Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q2K551 2.39e-27 108 30 4 238 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2ISN3 2.46e-27 108 33 7 219 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain HaA2)
Q5UW69 2.62e-27 108 31 6 214 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q2JLH7 2.91e-27 108 31 9 231 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q20ZP0 6.87e-27 107 30 6 235 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisB18)
Q7W148 2.82e-26 105 32 6 217 3 phnC Phosphonates import ATP-binding protein PhnC Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q2T3B8 3.75e-26 105 27 5 252 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q9AE30 3.97e-26 105 29 4 238 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium leguminosarum
Q0SWH9 4.25e-26 105 31 5 230 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain SM101 / Type A)
Q39B28 7.38e-26 105 27 5 244 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q98L75 7.53e-26 104 27 5 244 3 hmuV Hemin import ATP-binding protein HmuV Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q6NBX6 8.75e-26 104 32 9 226 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q7WNT8 9.51e-26 104 31 6 217 3 phnC Phosphonates import ATP-binding protein PhnC Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q0B697 1.02e-25 104 29 6 244 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q1R0Z6 1.31e-25 104 29 6 230 3 phnC Phosphonates import ATP-binding protein PhnC Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1BJA5 1.49e-25 104 28 7 249 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia orbicola (strain AU 1054)
A0B3E2 1.49e-25 104 28 7 249 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia cenocepacia (strain HI2424)
Q2FNX9 1.84e-25 103 29 7 253 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q0TUN8 2.37e-25 103 30 5 230 1 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8XNY7 4.03e-25 103 30 5 230 3 CPE0195 Putative ABC transporter ATP-binding protein CPE0195 Clostridium perfringens (strain 13 / Type A)
Q07LY2 4.61e-25 102 31 8 229 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain BisA53)
Q1H0W2 8.63e-25 102 30 7 232 3 hmuV Hemin import ATP-binding protein HmuV Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
C3LLU1 1.05e-24 101 30 7 246 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio cholerae serotype O1 (strain M66-2)
Q9KSL1 1.05e-24 101 30 7 246 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q62H59 1.43e-24 102 29 9 241 3 phnC Phosphonates import ATP-binding protein PhnC Burkholderia mallei (strain ATCC 23344)
Q63R24 2.23e-24 101 29 9 241 3 phnC Phosphonates import ATP-binding protein PhnC Burkholderia pseudomallei (strain K96243)
Q3JNY2 2.23e-24 101 29 9 241 3 phnC Phosphonates import ATP-binding protein PhnC Burkholderia pseudomallei (strain 1710b)
Q16BC5 2.95e-24 100 29 7 231 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q8TQ05 3.16e-24 104 29 8 242 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQ05 1.76e-17 84 26 5 236 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TK65 7.32e-24 102 29 5 225 3 MA_3551 Putative ABC transporter ATP-binding protein MA_3551 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q9RZU5 7.32e-24 99 25 6 245 3 hmuV Hemin import ATP-binding protein HmuV Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A5F1V0 7.4e-24 99 29 7 248 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q63NR0 1.18e-23 99 28 5 252 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia pseudomallei (strain K96243)
Q3JHM1 1.18e-23 99 28 5 252 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia pseudomallei (strain 1710b)
Q62A98 1.18e-23 99 28 5 252 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia mallei (strain ATCC 23344)
P48334 1.53e-23 98 29 7 237 3 None Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region Cyanophora paradoxa
Q8PZN0 1.97e-23 101 28 5 225 3 MM_0462 Putative ABC transporter ATP-binding protein MM_0462 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q03ZL6 2.44e-23 98 30 8 263 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q8CUY0 2.63e-23 97 27 8 249 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P27675 2.72e-23 97 30 8 244 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
Q58488 3.34e-23 98 28 6 233 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O27739 4.67e-23 98 27 6 227 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q6F0P3 7.91e-23 96 28 7 237 3 phnC Phosphonates import ATP-binding protein PhnC Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q50801 9.44e-23 97 28 4 213 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q74DN5 1.25e-22 95 30 5 217 3 GSU1281 Putative ABC transporter ATP-binding protein GSU1281 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q832R5 1.27e-22 99 30 3 227 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q832R5 6.38e-13 71 26 8 224 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q882S0 1.36e-22 96 27 8 246 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q032D0 1.42e-22 95 29 7 231 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. cremoris (strain SK11)
Q8UIW7 1.81e-22 96 26 7 229 3 phnC Phosphonates import ATP-binding protein PhnC Agrobacterium fabrum (strain C58 / ATCC 33970)
A3CVD3 1.85e-22 96 26 5 236 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q9RKC6 1.92e-22 95 28 3 211 3 SCO3161 Putative ABC transporter ATP-binding protein SCO3161 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q48HL2 2.28e-22 95 25 7 247 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1GMA8 2.4e-22 95 29 8 244 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Ruegeria sp. (strain TM1040)
Q9CIQ6 3.04e-22 94 29 7 231 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. lactis (strain IL1403)
Q67JX4 3.08e-22 95 28 7 225 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q4ZU82 3.86e-22 95 25 7 247 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. syringae (strain B728a)
O26236 4.5e-22 95 28 5 215 3 MTH_133 Putative ABC transporter ATP-binding protein MTH_133 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q98GF5 4.92e-22 95 27 6 234 3 phnC Phosphonates import ATP-binding protein PhnC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q897I2 4.98e-22 97 30 4 211 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q897I2 2.96e-10 63 33 1 104 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q55281 6.2e-22 94 29 6 211 3 mntA Manganese transport system ATP-binding protein MntA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6MIP7 6.51e-22 94 28 7 234 3 phnC Phosphonates import ATP-binding protein PhnC Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
P42360 7e-22 94 26 5 237 1 scaC Manganese import ATP-binding protein ScaC Streptococcus gordonii
O84071 8.13e-22 94 27 4 233 3 CT_068 Probable metal transport system ATP-binding protein CT_068 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q8DY60 9.43e-22 97 28 5 239 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8DY60 1.06e-09 61 25 5 230 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
A7MVV6 9.49e-22 93 31 7 245 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio campbellii (strain ATCC BAA-1116)
Q6RCE0 1.13e-21 94 27 8 235 3 phnC Phosphonates import ATP-binding protein PhnC Stutzerimonas stutzeri
Q8U3E0 1.21e-21 93 31 8 222 3 PF0528 Putative ABC transporter ATP-binding protein PF0528 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q6YR39 1.71e-21 93 31 7 219 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Onion yellows phytoplasma (strain OY-M)
Q9PKX1 1.98e-21 92 27 5 233 3 TC_0339 Probable metal transport system ATP-binding protein TC_0339 Chlamydia muridarum (strain MoPn / Nigg)
Q57243 2.08e-21 93 25 4 227 3 HI_1272 Uncharacterized ABC transporter ATP-binding protein HI_1272 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9AB70 2.17e-21 92 29 8 236 3 phnC Phosphonates import ATP-binding protein PhnC Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q74I62 2.18e-21 95 30 4 226 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q74I62 4.76e-09 59 25 5 228 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q9KD30 2.39e-21 92 25 4 234 3 mntB Manganese transport system ATP-binding protein MntB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q04FM1 2.46e-21 93 28 5 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q8E3S6 2.61e-21 95 28 5 239 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q8E3S6 1.28e-09 61 25 5 225 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q2FRT7 4.02e-21 94 30 6 230 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q8TYV9 4.93e-21 92 30 8 208 3 MK0182 Putative ABC transporter ATP-binding protein MK0182 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
P72477 5.22e-21 92 27 5 236 3 abcX Putative ABC transporter ATP-binding protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9FUT3 5.45e-21 94 34 7 216 1 ABCB23 ABC transporter B family member 23, mitochondrial Arabidopsis thaliana
P54537 6.11e-21 91 27 5 211 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
O68106 6.54e-21 92 28 6 214 1 cbiO Cobalt import ATP-binding protein CbiO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q8RD07 6.69e-21 91 31 8 225 3 TTE0246 Putative ABC transporter ATP-binding protein TTE0246 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q02151 6.7e-21 91 27 4 240 3 ymeB Uncharacterized ABC transporter ATP-binding protein YmeB Lactococcus lactis subsp. lactis (strain IL1403)
Q2NIT5 6.93e-21 91 30 6 219 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Aster yellows witches'-broom phytoplasma (strain AYWB)
Q6LX68 8.1e-21 91 28 6 232 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q82HA2 8.25e-21 91 27 3 212 3 SAV_3608 Putative ABC transporter ATP-binding protein SAV_3608 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q1LKJ2 8.57e-21 92 26 9 246 3 nodI Nod factor export ATP-binding protein I Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q38UT9 9.28e-21 91 29 6 218 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q7N3Q4 1.1e-20 90 31 5 222 3 btuD Vitamin B12 import ATP-binding protein BtuD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
O57872 1.14e-20 90 30 4 209 3 PH0132 Putative ABC transporter ATP-binding protein PH0132 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8PSR0 1.22e-20 94 28 4 236 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PSR0 1.15e-16 82 26 4 221 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q2JPW6 1.46e-20 90 26 5 209 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q03ZL5 1.69e-20 90 27 6 222 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
O34900 2.36e-20 90 30 5 216 1 tcyN L-cystine import ATP-binding protein TcyN Bacillus subtilis (strain 168)
Q6D2F6 2.38e-20 91 31 8 221 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P39456 2.52e-20 89 28 7 230 1 tcyC L-cystine import ATP-binding protein TcyC Bacillus subtilis (strain 168)
O86751 2.54e-20 91 29 6 225 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q3SGJ8 2.81e-20 89 27 7 246 3 phnC Phosphonates import ATP-binding protein PhnC Thiobacillus denitrificans (strain ATCC 25259)
Q6KHL1 3.33e-20 90 28 5 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q56953 3.36e-20 90 26 5 220 3 yfeB Chelated iron transport system membrane protein YfeB Yersinia pestis
Q46TK4 4.57e-20 89 26 8 237 3 phnC Phosphonates import ATP-binding protein PhnC Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q9KFL0 5.01e-20 89 28 6 217 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9LVM1 5.52e-20 92 31 7 224 1 ABCB25 ABC transporter B family member 25, mitochondrial Arabidopsis thaliana
Q6YRJ4 5.83e-20 91 29 4 213 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q6YRJ4 0.000291 45 26 8 190 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q9Z8J5 6.15e-20 89 26 5 231 3 CPn_0348 Probable metal transport system ATP-binding protein CPn_0348/CP_0412/CPj0348/CpB0355 Chlamydia pneumoniae
Q92VJ2 6.25e-20 90 29 6 212 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q8RQL7 6.32e-20 88 29 6 215 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8XXY9 6.59e-20 90 28 11 242 3 nodI Nod factor export ATP-binding protein I Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
O34677 6.79e-20 88 28 7 244 2 glnQ Glutamine transport ATP-binding protein GlnQ Bacillus subtilis (strain 168)
Q52815 7.6e-20 88 29 8 212 3 aapP General L-amino acid transport ATP-binding protein AapP Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1MMZ3 8.14e-20 89 27 7 229 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q9M0G9 8.76e-20 91 33 8 217 1 ABCB24 ABC transporter B family member 24, mitochondrial Arabidopsis thaliana
Q93D97 9.15e-20 91 29 4 220 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q93D97 3.31e-13 72 26 6 230 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9WXX8 9.2e-20 88 30 9 239 3 TM_0124 Probable metal transport system ATP-binding protein TM_0124 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q21UI2 1.05e-19 90 29 7 217 3 modC Molybdenum import ATP-binding protein ModC Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q97SA3 1.09e-19 90 29 4 212 3 SP_0483 Putative ABC transporter ATP-binding protein SP_0483 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q97SA3 1.06e-09 61 26 9 229 3 SP_0483 Putative ABC transporter ATP-binding protein SP_0483 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P33360 1.17e-19 89 27 6 215 1 yehX Glycine betaine uptake system ATP-binding protein YehX Escherichia coli (strain K12)
Q5P4W2 1.19e-19 90 27 7 229 3 modC Molybdenum import ATP-binding protein ModC Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q6GDC0 1.21e-19 90 28 4 230 3 SAR2766 Putative ABC transporter ATP-binding protein SAR2766 Staphylococcus aureus (strain MRSA252)
Q6GDC0 6.46e-08 56 28 9 219 3 SAR2766 Putative ABC transporter ATP-binding protein SAR2766 Staphylococcus aureus (strain MRSA252)
Q93KD4 1.31e-19 87 27 5 197 1 tupC Tungstate uptake system ATP-binding protein TupC Peptoclostridium acidaminophilum
Q14Q07 1.59e-19 89 30 7 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Spiroplasma citri
Q57BC2 1.71e-19 87 29 6 218 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella abortus biovar 1 (strain 9-941)
Q2YLW6 1.71e-19 87 29 6 218 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella abortus (strain 2308)
Q73F66 1.82e-19 88 26 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q88YN5 1.98e-19 87 29 6 217 3 phnC Phosphonates import ATP-binding protein PhnC Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q5HCL3 2.05e-19 90 28 4 230 3 SACOL2708 Putative ABC transporter ATP-binding protein SACOL2708 Staphylococcus aureus (strain COL)
Q5HCL3 3.4e-09 60 27 9 219 3 SACOL2708 Putative ABC transporter ATP-binding protein SACOL2708 Staphylococcus aureus (strain COL)
Q03203 2.05e-19 90 33 8 221 3 nisT Nisin transport ATP-binding protein NisT Lactococcus lactis subsp. lactis
Q03EE4 2.15e-19 87 28 4 223 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q2KBP5 2.33e-19 86 29 7 211 1 bioM Biotin transport ATP-binding protein BioM Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q13LC4 2.54e-19 88 28 9 243 3 phnC Phosphonates import ATP-binding protein PhnC Paraburkholderia xenovorans (strain LB400)
P10346 2.78e-19 86 31 7 210 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
Q8R7Y4 2.9e-19 87 29 6 218 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q99QV7 3.06e-19 89 27 4 230 3 SAV2684 Putative ABC transporter ATP-binding protein SAV2684 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q99QV7 3.53e-09 60 27 9 219 3 SAV2684 Putative ABC transporter ATP-binding protein SAV2684 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A342 3.06e-19 89 27 4 230 3 SA2476 Putative ABC transporter ATP-binding protein SA2476 Staphylococcus aureus (strain N315)
Q7A342 3.53e-09 60 27 9 219 3 SA2476 Putative ABC transporter ATP-binding protein SA2476 Staphylococcus aureus (strain N315)
O28437 3.19e-19 86 28 6 213 3 AF_1841 Putative ABC transporter ATP-binding protein AF_1841 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q10V16 3.23e-19 87 26 5 208 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Trichodesmium erythraeum (strain IMS101)
Q3SJC6 3.31e-19 88 26 4 225 3 modC Molybdenum import ATP-binding protein ModC Thiobacillus denitrificans (strain ATCC 25259)
Q9KFN9 3.37e-19 87 30 9 234 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5L3Q9 3.38e-19 87 27 6 216 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Geobacillus kaustophilus (strain HTA426)
Q1LQB5 3.39e-19 87 27 8 236 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A8AHA1 3.54e-19 86 28 5 228 3 btuD Vitamin B12 import ATP-binding protein BtuD Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8FYU9 3.55e-19 86 29 6 218 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella suis biovar 1 (strain 1330)
Q8YJ04 3.55e-19 86 29 6 218 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q88XV1 3.58e-19 87 27 5 216 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q166X0 3.86e-19 87 28 6 218 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q65P76 3.96e-19 87 26 6 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P63354 4.08e-19 88 30 8 235 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella suis biovar 1 (strain 1330)
P63353 4.08e-19 88 30 8 235 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q6GEL4 4.11e-19 87 27 6 229 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MRSA252)
Q8NUH8 4.27e-19 89 28 4 230 3 MW2603 Putative ABC transporter ATP-binding protein MW2603 Staphylococcus aureus (strain MW2)
Q8NUH8 7.14e-09 59 27 9 219 3 MW2603 Putative ABC transporter ATP-binding protein MW2603 Staphylococcus aureus (strain MW2)
Q6G5Z1 4.27e-19 89 28 4 230 3 SAS2569 Putative ABC transporter ATP-binding protein SAS2569 Staphylococcus aureus (strain MSSA476)
Q6G5Z1 7.14e-09 59 27 9 219 3 SAS2569 Putative ABC transporter ATP-binding protein SAS2569 Staphylococcus aureus (strain MSSA476)
Q8DQY5 4.34e-19 89 29 4 217 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8DQY5 1.66e-10 63 26 7 229 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q82WT5 4.45e-19 88 28 7 232 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q6D201 4.91e-19 87 30 4 210 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P74548 4.95e-19 88 28 6 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6LQ77 5.16e-19 86 24 4 252 3 btuD Vitamin B12 import ATP-binding protein BtuD Photobacterium profundum (strain SS9)
Q65P77 5.29e-19 87 31 4 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q2KDV1 5.35e-19 87 26 7 229 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q92V71 5.57e-19 86 26 7 223 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium meliloti (strain 1021)
Q8R7Y5 5.69e-19 87 27 5 225 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q4L885 5.78e-19 86 27 8 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus haemolyticus (strain JCSC1435)
Q9MUN1 6.24e-19 87 28 6 223 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q6HPM9 6.35e-19 87 26 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ1 6.35e-19 87 26 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus anthracis
P37774 7.24e-19 85 26 8 249 1 tcyN L-cystine transport system ATP-binding protein TcyN Escherichia coli (strain K12)
Q7NX01 7.96e-19 87 28 7 225 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2S3A3 8.47e-19 86 30 7 208 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salinibacter ruber (strain DSM 13855 / M31)
Q92UV5 9.35e-19 87 29 5 210 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhizobium meliloti (strain 1021)
Q30W28 1.01e-18 85 25 8 248 3 phnC Phosphonates import ATP-binding protein PhnC Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q8TTN2 1.01e-18 87 26 6 230 3 MA_0394 Putative ABC transporter ATP-binding protein MA_0394 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
A0R8K9 1.01e-18 86 26 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis (strain Al Hakam)
Q839D4 1.14e-18 86 28 5 214 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q9I6L0 1.21e-18 86 28 5 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5FMM1 1.32e-18 85 31 10 237 3 phnC Phosphonates import ATP-binding protein PhnC Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q8REG7 1.37e-18 85 25 7 222 3 phnC Phosphonates import ATP-binding protein PhnC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A3DJK5 1.43e-18 85 29 4 202 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q8D2U8 1.5e-18 87 26 7 223 3 msbA ATP-dependent lipid A-core flippase Wigglesworthia glossinidia brevipalpis
Q71WH8 1.52e-18 85 27 5 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serotype 4b (strain F2365)
Q11D92 1.54e-18 85 30 5 200 3 thiQ Thiamine import ATP-binding protein ThiQ Chelativorans sp. (strain BNC1)
Q7A1Z1 1.77e-18 85 28 7 229 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain MW2)
Q6GCY2 1.77e-18 85 28 7 229 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain MSSA476)
Q7A848 1.77e-18 85 28 7 229 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain N315)
Q99X73 1.77e-18 85 28 7 229 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJM6 1.77e-18 85 28 7 229 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain COL)
Q2G1L8 1.77e-18 85 28 7 229 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKB7 1.77e-18 85 28 7 229 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain USA300)
Q2YYM5 1.79e-18 85 27 6 229 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
P70970 1.81e-18 85 27 5 218 3 ecfAB Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus subtilis (strain 168)
A3CRB9 1.96e-18 85 29 6 221 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus sanguinis (strain SK36)
Q9HYL7 1.98e-18 85 26 9 245 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4L884 2.03e-18 85 26 5 223 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus haemolyticus (strain JCSC1435)
O34697 2.04e-18 84 29 7 215 1 bceA Bacitracin export ATP-binding protein BceA Bacillus subtilis (strain 168)
Q73F67 2.1e-18 85 29 10 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)
B2U358 2.22e-18 84 26 5 233 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q88XV2 2.31e-18 85 30 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8Y455 2.35e-18 85 26 5 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P06611 2.36e-18 84 27 5 228 1 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain K12)
B1XG16 2.36e-18 84 27 5 228 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain K12 / DH10B)
C4ZYH1 2.36e-18 84 27 5 228 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain K12 / MC4100 / BW2952)
Q0I5E9 2.44e-18 85 26 7 240 3 metN Methionine import ATP-binding protein MetN Histophilus somni (strain 129Pt)
Q81J15 2.47e-18 85 26 6 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A0ALT7 2.54e-18 85 27 7 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q0K1N8 2.59e-18 85 27 8 237 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8RI39 2.61e-18 86 29 8 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q2YUY7 2.67e-18 84 28 7 229 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q97JB8 2.75e-18 84 26 7 234 3 CA_C1368 Putative ABC transporter ATP-binding protein CA_C1368 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q321G6 2.93e-18 84 26 5 233 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella boydii serotype 4 (strain Sb227)
Q9CIS8 2.94e-18 85 28 5 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. lactis (strain IL1403)
Q3Z257 3.18e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella sonnei (strain Ss046)
Q7C1M3 3.18e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella flexneri
Q0T4R9 3.18e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella flexneri serotype 5b (strain 8401)
Q32FJ0 3.18e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella dysenteriae serotype 1 (strain Sd197)
B1LE21 3.18e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain SMS-3-5 / SECEC)
B6I8R4 3.18e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain SE11)
B7N547 3.18e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1IPL8 3.18e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0Q1 3.18e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O9:H4 (strain HS)
B7M1B8 3.18e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O8 (strain IAI1)
B7NTS2 3.18e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7L6I2 3.18e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain 55989 / EAEC)
A7ZMH7 3.18e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O139:H28 (strain E24377A / ETEC)
Q02QM1 3.26e-18 84 26 9 245 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q7A088 3.36e-18 84 26 5 221 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MW2)
Q6G7A0 3.36e-18 84 26 5 221 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MSSA476)
Q7A471 3.36e-18 84 26 5 221 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain N315)
Q99S48 3.36e-18 84 26 5 221 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HDY7 3.36e-18 84 26 5 221 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain COL)
Q2FW35 3.36e-18 84 26 5 221 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER8 3.36e-18 84 26 5 221 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain USA300)
O34814 3.42e-18 83 31 9 217 1 ftsE Cell division ATP-binding protein FtsE Bacillus subtilis (strain 168)
Q65VG9 3.5e-18 85 27 6 216 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q1RB86 3.52e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain UTI89 / UPEC)
Q8FH28 3.52e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0THB9 3.52e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABP5 3.52e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O1:K1 / APEC
B7MV91 3.52e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O81 (strain ED1a)
B7MAS0 3.52e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O45:K1 (strain S88 / ExPEC)
B7US48 3.52e-18 84 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q83MG3 4.04e-18 83 27 6 211 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella flexneri
Q6GKG3 4.4e-18 84 28 7 229 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain MRSA252)
Q21Y06 4.49e-18 84 26 6 227 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q87Q38 4.63e-18 84 29 7 245 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9K619 4.81e-18 83 28 8 218 3 bceA Bacitracin export ATP-binding protein BceA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P26050 4.92e-18 84 27 7 209 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q5FL41 4.92e-18 85 28 6 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q6KHL2 5.04e-18 84 27 5 233 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q2RFS8 5.26e-18 84 26 4 227 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q927N8 5.27e-18 84 27 5 222 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q4KK46 5.38e-18 85 29 7 214 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
O52618 5.43e-18 84 28 7 209 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti (strain 1021)
O31339 5.62e-18 85 30 7 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8ETV6 5.81e-18 84 27 5 224 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q160Y9 6.16e-18 83 28 8 238 3 znuC Zinc import ATP-binding protein ZnuC Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q81J16 6.48e-18 84 28 10 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9V2E4 6.53e-18 83 29 7 210 3 PYRAB01300 Putative ABC transporter ATP-binding protein PYRAB01300 Pyrococcus abyssi (strain GE5 / Orsay)
Q92CK1 6.6e-18 83 26 4 223 3 lin1170 Putative ABC transporter ATP-binding protein lin1170 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8KLG1 6.69e-18 84 24 10 265 3 nodI Nod factor export ATP-binding protein I Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P63351 6.92e-18 83 26 6 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63352 6.92e-18 83 26 6 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella typhi
B4TGI0 6.92e-18 83 26 6 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella heidelberg (strain SL476)
B5FJ99 6.92e-18 83 26 6 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella dublin (strain CT_02021853)
Q57PU4 6.92e-18 83 26 6 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella choleraesuis (strain SC-B67)
B5QVV9 7.14e-18 83 26 6 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella enteritidis PT4 (strain P125109)
Q8GNH6 7.77e-18 84 29 8 211 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti
Q6MUF4 7.96e-18 83 29 12 251 3 phnC Phosphonates import ATP-binding protein PhnC Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q927N9 8e-18 83 26 5 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A1BE50 8.08e-18 85 28 10 251 3 macB Macrolide export ATP-binding/permease protein MacB Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q21GS5 8.43e-18 84 30 8 212 3 modC Molybdenum import ATP-binding protein ModC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q71WH7 8.93e-18 83 27 7 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serotype 4b (strain F2365)
Q5LVC2 9.07e-18 83 29 6 221 3 phnC Phosphonates import ATP-binding protein PhnC Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q8RGC8 9.49e-18 84 27 7 219 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q7N6Z2 9.68e-18 84 29 10 239 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8Y454 9.98e-18 83 27 7 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q03PY6 1.1e-17 83 26 6 224 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
P32010 1.11e-17 84 28 6 217 1 drrA Daunorubicin/doxorubicin resistance ATP-binding protein DrrA Streptomyces peucetius
A0ALT6 1.14e-17 83 26 5 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q9K8N1 1.14e-17 82 25 6 228 3 phnC3 Phosphonates import ATP-binding protein PhnC 3 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q73R11 1.14e-17 85 29 6 209 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73R11 6.84e-09 59 23 5 224 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q81GU1 1.16e-17 84 31 7 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q326G9 1.18e-17 82 28 5 199 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella boydii serotype 4 (strain Sb227)
Q0T8D1 1.33e-17 82 28 5 199 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella flexneri serotype 5b (strain 8401)
Q74K65 1.43e-17 84 28 8 245 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8PUE7 1.44e-17 84 31 8 218 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 1.66e-11 67 27 5 203 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q81ZF5 1.44e-17 83 27 7 228 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
B5YPZ7 1.45e-17 82 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X5W0 1.45e-17 82 26 5 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O157:H7
Q8U4L3 1.48e-17 82 28 4 205 3 PF0068 Putative ABC transporter ATP-binding protein PF0068 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q3KJS6 1.52e-17 84 28 7 214 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain Pf0-1)
Q6HP89 1.53e-17 83 27 7 228 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q1GKZ0 1.55e-17 82 28 6 218 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Ruegeria sp. (strain TM1040)
Q7MLE6 1.55e-17 82 27 6 243 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio vulnificus (strain YJ016)
Q6D654 1.58e-17 82 28 5 229 3 btuD Vitamin B12 import ATP-binding protein BtuD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3Z5U5 1.63e-17 82 28 5 199 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella sonnei (strain Ss046)
Q88RL5 1.69e-17 83 27 4 214 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q6HPN0 1.78e-17 82 28 10 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 1.78e-17 82 28 10 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 1.78e-17 82 28 10 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
Q1J982 1.79e-17 82 30 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q329I3 1.94e-17 82 26 6 225 3 phnC Phosphonates import ATP-binding protein PhnC Shigella dysenteriae serotype 1 (strain Sd197)
Q9Z3I3 2.06e-17 82 27 8 213 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium sp. (strain SNU001)
Q2NHA1 2.1e-17 82 30 6 220 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q8TQW9 2.18e-17 84 30 8 224 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQW9 1.6e-09 61 22 5 213 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
P48243 2.26e-17 81 28 6 214 1 gluA Glutamate transport ATP-binding protein GluA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q046T0 2.27e-17 82 30 10 239 3 phnC Phosphonates import ATP-binding protein PhnC Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q8ZX91 2.28e-17 82 27 7 222 3 pstB Phosphate import ATP-binding protein PstB Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q03AH0 2.33e-17 83 27 6 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q1RGD0 2.34e-17 81 28 4 198 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli (strain UTI89 / UPEC)
O34362 2.37e-17 84 24 5 230 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
O34362 3.74e-09 60 24 5 204 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
Q49ZE0 2.43e-17 82 28 6 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9NP58 2.44e-17 84 29 7 217 1 ABCB6 ATP-binding cassette sub-family B member 6 Homo sapiens
Q7MN25 2.44e-17 83 25 9 235 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain YJ016)
Q8DFC3 2.59e-17 83 25 9 235 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain CMCP6)
P33916 2.7e-17 84 26 7 233 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P33916 4.44e-07 53 21 7 222 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
B5BA33 2.72e-17 81 26 6 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella paratyphi A (strain AKU_12601)
Q5PH81 2.72e-17 81 26 6 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q48QM2 2.83e-17 82 30 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JJC9 2.83e-17 82 30 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
P0C0E8 2.83e-17 82 30 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M1
Q92XW1 2.91e-17 82 30 7 214 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Rhizobium meliloti (strain 1021)
Q8D653 2.98e-17 82 28 6 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio vulnificus (strain CMCP6)
P0C0E9 3e-17 82 30 4 200 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Streptococcus pyogenes
P0CZ29 3e-17 82 30 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RH11 3e-17 82 30 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J449 3e-17 82 30 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC8 3e-17 82 30 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q7CMM7 3e-17 82 30 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B5 3e-17 82 30 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ28 3e-17 82 30 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q6BXD7 3.04e-17 84 29 8 221 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q8YUI9 3.05e-17 81 26 6 237 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P56344 3.4e-17 81 28 6 211 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q81IN8 3.47e-17 82 27 7 228 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q1IGZ0 3.48e-17 82 27 4 214 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
A2RI02 3.52e-17 82 27 5 215 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain MG1363)
Q8XK20 3.53e-17 83 29 5 213 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8XK20 2.54e-13 72 27 8 227 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q1M7W6 3.61e-17 82 26 9 223 3 nodI Nod factor export ATP-binding protein I Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q0TLS2 3.74e-17 80 28 4 198 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FL82 3.9e-17 80 28 4 198 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q63GR8 3.95e-17 82 27 7 228 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
Q2UPC0 4.14e-17 83 28 8 228 3 aclQ ABC transporter aclQ Aspergillus oryzae (strain ATCC 42149 / RIB 40)
P45073 4.19e-17 80 25 7 226 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q1GB17 4.2e-17 82 28 5 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q60AA3 4.25e-17 83 25 8 250 3 msbA ATP-dependent lipid A-core flippase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9DC29 4.27e-17 83 29 7 217 1 Abcb6 ATP-binding cassette sub-family B member 6 Mus musculus
Q59R09 4.34e-17 83 28 8 231 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Candida albicans (strain SC5314 / ATCC MYA-2876)
Q4L9P7 4.45e-17 81 28 9 248 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus haemolyticus (strain JCSC1435)
Q6D664 4.46e-17 80 28 9 210 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q58903 4.56e-17 80 32 8 207 3 MJ1508 Uncharacterized ABC transporter ATP-binding protein MJ1508 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q73EL7 4.63e-17 82 27 7 228 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q04BG2 4.68e-17 82 28 5 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q6AJW3 4.71e-17 83 28 8 239 3 msbA ATP-dependent lipid A-core flippase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q18CI9 4.72e-17 81 27 6 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridioides difficile (strain 630)
Q8EBC3 4.82e-17 82 27 7 226 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9K876 4.92e-17 82 28 7 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8XA06 4.93e-17 80 28 5 199 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O157:H7
Q5E882 5.27e-17 80 27 6 212 3 thiQ Thiamine import ATP-binding protein ThiQ Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q32K28 5.3e-17 80 28 5 199 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella dysenteriae serotype 1 (strain Sd197)
Q92EZ6 5.38e-17 82 25 6 225 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P40735 5.38e-17 81 30 6 216 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus subtilis (strain 168)
P31548 5.41e-17 80 28 5 199 1 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli (strain K12)
Q02592 5.7e-17 83 31 9 226 2 hmt1 Heavy metal tolerance protein Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q032H3 5.83e-17 81 27 5 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain SK11)
Q8Y7R4 5.85e-17 80 25 4 223 3 lmo1207 Putative ABC transporter ATP-binding protein lmo1207 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8TIX0 6.04e-17 82 24 5 213 3 MA_4020 Putative ABC transporter ATP-binding protein MA_4020 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q1IGN4 6.1e-17 82 25 6 224 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas entomophila (strain L48)
Q4WSI1 6.25e-17 83 28 7 219 2 mdr4 ABC multidrug transporter mdr4 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WSI1 2.57e-09 60 24 5 220 2 mdr4 ABC multidrug transporter mdr4 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q92AF9 6.32e-17 80 25 5 219 3 mntB Manganese transport system ATP-binding protein MntB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q1QE80 6.35e-17 82 27 6 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q748K0 6.54e-17 81 29 6 212 3 GSU3001 Putative ABC transporter ATP-binding protein GSU3001 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
P45022 6.68e-17 80 28 7 237 3 HI_1078 Probable amino-acid ABC transporter ATP-binding protein HI_1078 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q88RB3 6.8e-17 82 27 8 227 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9CJB8 6.93e-17 82 27 2 214 3 lcnC Lactococcin transport/processing ATP-binding protein LcnC-like Lactococcus lactis subsp. lactis (strain IL1403)
Q31TP8 6.98e-17 80 24 5 228 3 phnC Phosphonates import ATP-binding protein PhnC Shigella boydii serotype 4 (strain Sb227)
Q4A5A4 7.26e-17 81 28 8 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmopsis synoviae (strain 53)
B7VPD0 7.28e-17 80 25 6 258 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio atlanticus (strain LGP32)
P31134 7.38e-17 82 26 6 217 1 potG Putrescine transport ATP-binding protein PotG Escherichia coli (strain K12)
Q1BWI2 7.57e-17 81 26 6 216 3 nodI Nod factor export ATP-binding protein I Burkholderia orbicola (strain AU 1054)
Q1R3F6 7.72e-17 80 25 5 228 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain UTI89 / UPEC)
Q63H61 7.81e-17 81 27 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ZK / E33L)
Q1LQD3 8.13e-17 82 27 7 225 3 msbA ATP-dependent lipid A-core flippase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q74LQ3 8.22e-17 80 30 9 227 3 phnC Phosphonates import ATP-binding protein PhnC Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q39GT7 8.37e-17 81 25 6 220 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8YUV1 8.4e-17 80 29 7 221 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8FAV1 8.81e-17 80 25 5 224 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q5PGH0 8.86e-17 82 26 8 230 3 msbA ATP-dependent lipid A-core flippase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q88CL2 8.97e-17 81 28 5 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q4WPP6 9.29e-17 82 29 5 215 2 mdr2 ABC multidrug transporter mdr2 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q5E586 9.58e-17 81 29 6 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q6FFL0 9.62e-17 80 25 6 221 3 znuC Zinc import ATP-binding protein ZnuC Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q48PN3 9.73e-17 81 26 6 224 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8E9I8 1.04e-16 80 25 8 237 3 pstB2 Phosphate import ATP-binding protein PstB 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q5HDY6 1.05e-16 80 28 7 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain COL)
Q2FW34 1.05e-16 80 28 7 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER7 1.05e-16 80 28 7 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain USA300)
Q720M2 1.12e-16 80 25 4 216 3 LMOf2365_1216 Putative ABC transporter ATP-binding protein LMOf2365_1216 Listeria monocytogenes serotype 4b (strain F2365)
Q63H62 1.12e-16 80 28 10 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ZK / E33L)
Q97ZT9 1.14e-16 80 25 5 226 3 pstB Phosphate import ATP-binding protein PstB Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
A0A125QXJ1 1.15e-16 82 28 7 217 2 ABCB6 ATP-binding cassette sub-family B member 6 Mesocricetus auratus
Q9CN78 1.16e-16 79 30 9 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pasteurella multocida (strain Pm70)
Q8UA73 1.18e-16 81 27 7 213 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2K6L3 1.19e-16 81 28 9 236 3 ugpC1 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q0T9T7 1.21e-16 80 24 5 228 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q65TB7 1.22e-16 79 31 8 204 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P08720 1.22e-16 80 26 9 223 3 nodI Nod factor export ATP-binding protein I Rhizobium leguminosarum bv. viciae
Q8YA75 1.25e-16 81 25 6 225 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q73GK9 1.32e-16 79 26 8 234 3 znuC Zinc import ATP-binding protein ZnuC Wolbachia pipientis wMel
Q831K6 1.36e-16 81 28 5 208 1 metN2 Methionine import ATP-binding protein MetN 2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q38UU0 1.39e-16 80 27 6 222 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Latilactobacillus sakei subsp. sakei (strain 23K)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_01890
Feature type CDS
Gene fepC
Product ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
Location 364048 - 364788 (strand: -1)
Length 741 (nucleotides) / 246 (amino acids)
In genomic island -

Contig

Accession ZDB_359
Length 392768 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_200
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1120 Inorganic ion transport and metabolism (P)
Coenzyme transport and metabolism (H)
PH ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02013 iron complex transport system ATP-binding protein [EC:7.2.2.-] - -

Protein Sequence

MSTVDINDLNYNGILKDINLSFSGKRVIGIVGPNGSGKTTLLRHIYRDIKTRGTVFFDNTDVAQFSVKSLARNISVLTQFNDQVEGKLTIEEIVVMGRMPYKKHYVDYSDRDFVIADNYMALFGLQKMKNKEYHALSGGEKQRVMLAKCFSQETDIMILDEPTNHLDIRYKVEVMKALAASESTVIMTIHDINLSAKYCQHLILMNDGQIYAQGTPAEVLTRECLFDVFGVEFTVLPVEDRVAIFL

Flanking regions ( +/- flanking 50bp)

CGCGCCGCTGTTTGTTTATATCATTATTAAAGCGAACAGGAGCCGGTAACGTGAGTACTGTTGATATTAATGACCTGAATTATAACGGGATACTGAAAGACATTAATCTGTCATTTTCCGGCAAAAGAGTGATCGGTATTGTCGGGCCTAACGGCTCTGGTAAAACGACTTTATTACGGCATATTTACCGGGATATCAAAACCCGGGGCACCGTTTTCTTTGATAACACGGATGTGGCTCAGTTCTCCGTCAAATCACTCGCCCGCAATATCTCGGTACTGACGCAGTTTAATGACCAGGTGGAAGGCAAACTGACCATTGAGGAAATCGTGGTGATGGGGCGGATGCCGTATAAAAAACATTACGTGGATTACAGCGACCGGGATTTTGTGATTGCAGACAACTACATGGCATTGTTTGGTCTGCAGAAAATGAAAAATAAAGAGTATCACGCACTGTCCGGTGGTGAGAAACAGCGGGTGATGCTGGCGAAATGTTTTTCCCAGGAAACCGATATTATGATCCTGGATGAGCCGACCAACCACCTGGATATCCGCTATAAAGTGGAAGTAATGAAAGCGCTGGCCGCATCAGAATCCACCGTAATTATGACCATTCACGATATTAATTTATCCGCAAAATACTGTCAGCATCTGATCCTGATGAATGACGGGCAAATTTATGCGCAGGGCACACCGGCGGAAGTACTAACCCGGGAGTGCCTGTTTGATGTATTTGGTGTGGAATTTACGGTATTACCGGTAGAAGACCGTGTTGCTATATTTTTATAATCCGGATGAGGAAATTATGAAAAAATTATTATTAGGTACCCTGGTTATCT