Homologs in group_688

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02845 FBDBKF_02845 34.9 Morganella morganii S1 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
EHELCC_03315 EHELCC_03315 34.9 Morganella morganii S2 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
NLDBIP_00145 NLDBIP_00145 34.9 Morganella morganii S4 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
LHKJJB_01890 LHKJJB_01890 34.9 Morganella morganii S3 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
HKOGLL_01930 HKOGLL_01930 34.9 Morganella morganii S5 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
F4V73_RS05285 F4V73_RS05285 33.6 Morganella psychrotolerans - ABC transporter ATP-binding protein

Distribution of the homologs in the orthogroup group_688

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_688

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P94420 3.02e-99 292 52 0 251 1 yclP Petrobactin import ATP-binding protein YclP Bacillus subtilis (strain 168)
Q81XB3 1.46e-96 285 56 0 250 1 fatE Petrobactin import ATP-binding protein FatE Bacillus anthracis
Q81LM1 8.14e-59 190 38 1 247 1 fpuC Petrobactin import ATP-binding protein FpuC Bacillus anthracis
O34510 1.24e-58 189 36 2 246 3 yfmF Fe(3+)-citrate import ATP-binding protein YfmF Bacillus subtilis (strain 168)
P49938 5.07e-58 188 38 1 231 3 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Bacillus subtilis (strain 168)
P07821 2.6e-57 186 36 1 238 1 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Escherichia coli (strain K12)
P15031 1.89e-55 181 38 2 240 1 fecE Fe(3+) dicitrate transport ATP-binding protein FecE Escherichia coli (strain K12)
Q47087 1.36e-54 179 38 1 226 3 cbrD Achromobactin transport ATP-binding protein CbrD Dickeya dadantii (strain 3937)
O32188 9.62e-54 177 36 1 242 1 yusV Probable siderophore transport system ATP-binding protein YusV Bacillus subtilis (strain 168)
P23878 3.04e-53 176 38 1 225 1 fepC Ferric enterobactin transport ATP-binding protein FepC Escherichia coli (strain K12)
Q81V82 3.25e-53 176 36 1 234 1 fpuD Petrobactin import ATP-binding protein FpuD Bacillus anthracis
Q92N13 1.31e-45 156 34 4 242 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium meliloti (strain 1021)
Q58283 1.95e-45 156 36 1 236 3 MJ0873 Uncharacterized ABC transporter ATP-binding protein MJ0873 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q2RZ08 3.78e-45 155 30 2 246 3 hmuV Hemin import ATP-binding protein HmuV Salinibacter ruber (strain DSM 13855 / M31)
Q8CUY0 6.78e-42 146 35 4 243 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q98L75 1.09e-40 143 31 3 243 3 hmuV Hemin import ATP-binding protein HmuV Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q93SH7 4.11e-40 142 33 4 251 3 hmuV Hemin import ATP-binding protein HmuV Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q57554 5.63e-40 141 33 2 223 3 MJ0089 Uncharacterized ABC transporter ATP-binding protein MJ0089 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9HQ18 9.04e-40 144 31 0 238 1 btuD Cobalamin import ATP-binding protein BtuD Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G4 9.04e-40 144 31 0 238 3 btuD Cobalamin import ATP-binding protein BtuD Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q2JLH7 9.72e-40 141 35 5 243 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q217B2 1.1e-39 141 34 5 239 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB18)
Q7N3S7 1.27e-38 138 29 2 240 3 hmuV Hemin import ATP-binding protein HmuV Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q84EY8 2e-38 137 30 2 231 3 hmuV Hemin import ATP-binding protein HmuV Enterobacter cloacae
Q12R52 2.19e-38 137 31 2 238 3 hmuV Hemin import ATP-binding protein HmuV Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q9RKQ4 3.11e-38 137 32 1 225 3 hmuV Hemin import ATP-binding protein HmuV Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q1I4Q5 1.59e-37 135 30 3 250 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas entomophila (strain L48)
Q6G475 2.56e-37 135 30 5 253 3 hmuV Hemin import ATP-binding protein HmuV Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q07LU3 3.18e-37 134 32 4 239 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisA53)
Q66FK0 4.76e-37 134 26 2 257 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CE65 4.76e-37 134 26 2 257 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Nepal516)
Q56993 4.76e-37 134 26 2 257 1 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis
Q1C0Q8 4.76e-37 134 26 2 257 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Antiqua)
Q8EB59 1.75e-36 132 31 3 237 3 hmuV Hemin import ATP-binding protein HmuV Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
O68877 3.06e-36 132 30 3 250 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02FW7 3.06e-36 132 30 3 250 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas aeruginosa (strain UCBPP-PA14)
Q6D645 3.27e-36 132 30 3 240 3 hmuV Hemin import ATP-binding protein HmuV Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6G098 3.66e-36 132 30 5 253 3 hmuV Hemin import ATP-binding protein HmuV Bartonella quintana (strain Toulouse)
Q6N7Y6 4.49e-36 132 33 3 235 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
O34631 4.63e-36 135 32 1 234 3 yvrA Uncharacterized ABC transporter ATP-binding protein YvrA Bacillus subtilis (strain 168)
Q70YG7 5.72e-36 131 32 4 240 1 hmuV Hemin import ATP-binding protein HmuV Vibrio anguillarum (strain ATCC 68554 / 775)
Q03ZQ0 9.27e-36 133 35 4 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q4K5Z7 1.03e-35 130 28 3 250 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q11ID5 1.14e-35 130 30 4 251 3 hmuV Hemin import ATP-binding protein HmuV Chelativorans sp. (strain BNC1)
Q138A9 1.17e-35 130 31 4 235 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB5)
Q72AQ6 1.29e-35 130 34 6 240 3 phnC Phosphonates import ATP-binding protein PhnC Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P74981 1.32e-35 130 27 2 257 1 hmuV Hemin import ATP-binding protein HmuV Yersinia enterocolitica
Q5E5I1 1.5e-35 130 34 7 244 3 hmuV Hemin import ATP-binding protein HmuV Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8D653 1.61e-35 132 32 2 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio vulnificus (strain CMCP6)
Q87J32 1.81e-35 130 32 5 236 3 hmuV Hemin import ATP-binding protein HmuV Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7W025 2.35e-35 129 30 3 237 3 hmuV Hemin import ATP-binding protein HmuV Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q5L222 3.02e-35 131 31 3 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
Q7W359 4.26e-35 129 30 3 237 3 hmuV Hemin import ATP-binding protein HmuV Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q88DY1 4.4e-35 129 29 3 250 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2J3T0 4.54e-35 129 32 5 249 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain HaA2)
Q7WEH6 6.32e-35 128 30 3 237 3 hmuV Hemin import ATP-binding protein HmuV Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2ISN3 6.45e-35 129 32 3 233 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain HaA2)
Q8L1U3 7.01e-35 128 30 4 232 1 hmuV Hemin import ATP-binding protein HmuV Bordetella avium
Q2KUC0 7.01e-35 128 30 4 232 3 hmuV Hemin import ATP-binding protein HmuV Bordetella avium (strain 197N)
Q1MCZ1 1.1e-34 128 31 5 254 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P9WQM1 1.32e-34 130 33 3 237 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQM0 1.32e-34 130 33 3 237 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4W3 1.32e-34 130 33 3 237 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q32AY3 1.38e-34 127 28 2 247 3 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae serotype 1 (strain Sd197)
Q6LQC0 1.38e-34 128 31 5 229 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium profundum (strain SS9)
Q70GD4 2.16e-34 127 31 4 233 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damsela subsp. piscicida
Q1R597 3.3e-34 126 28 2 245 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli (strain UTI89 / UPEC)
O70014 3.59e-34 126 28 2 247 1 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae
Q7M8M4 4.1e-34 127 32 3 240 3 phnC Phosphonates import ATP-binding protein PhnC Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q132E8 4.14e-34 126 30 4 248 3 phnC Phosphonates import ATP-binding protein PhnC Rhodopseudomonas palustris (strain BisB5)
Q659V4 5.01e-34 126 31 4 233 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damselae subsp. damselae
P74548 5.44e-34 128 33 3 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8FCJ1 5.5e-34 126 28 2 245 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBU8 5.5e-34 126 28 2 245 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0SIB7 6.16e-34 127 30 1 226 3 hmuV Hemin import ATP-binding protein HmuV Rhodococcus jostii (strain RHA1)
Q8X5N2 9.97e-34 125 28 2 245 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O157:H7
Q1GMA8 1.95e-33 124 34 3 238 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Ruegeria sp. (strain TM1040)
Q6D734 3.28e-33 126 30 2 225 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q16BC5 3.44e-33 124 31 6 257 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q8Y651 5.04e-33 123 34 6 241 3 mntB Manganese transport system ATP-binding protein MntB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q7AH43 6.88e-33 125 31 2 225 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli O157:H7
Q5YZY9 7.74e-33 125 33 3 238 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nocardia farcinica (strain IFM 10152)
Q2YUY7 8.19e-33 123 34 6 255 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q3K6R9 8.33e-33 123 30 3 245 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain Pf0-1)
Q9AE30 1.03e-32 123 31 5 252 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium leguminosarum
Q5YVL8 1.16e-32 123 29 1 224 3 hmuV Hemin import ATP-binding protein HmuV Nocardia farcinica (strain IFM 10152)
Q92AF9 1.3e-32 122 32 6 248 3 mntB Manganese transport system ATP-binding protein MntB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P14788 1.48e-32 124 33 3 226 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q7N8B9 1.51e-32 124 28 2 230 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1MMZ3 1.68e-32 122 29 3 257 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q3SQ65 1.8e-32 122 28 5 249 3 hmuV Hemin import ATP-binding protein HmuV Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q7NN36 1.9e-32 122 30 2 240 3 hmuV Hemin import ATP-binding protein HmuV Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q2NSR0 2.06e-32 122 27 2 237 3 hmuV Hemin import ATP-binding protein HmuV Sodalis glossinidius (strain morsitans)
Q07LY2 2.38e-32 122 30 5 244 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain BisA53)
Q6WB63 2.87e-32 122 32 5 256 3 phnC Phosphonates import ATP-binding protein PhnC Alcaligenes faecalis
Q5QXD0 3e-32 121 29 5 256 3 hmuV Hemin import ATP-binding protein HmuV Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A1TAI4 3.51e-32 124 34 2 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
P37009 3.66e-32 123 30 2 225 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli (strain K12)
Q7A1Z1 3.86e-32 121 34 6 255 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain MW2)
Q6GCY2 3.86e-32 121 34 6 255 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain MSSA476)
Q7A848 3.86e-32 121 34 6 255 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain N315)
Q99X73 3.86e-32 121 34 6 255 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJM6 3.86e-32 121 34 6 255 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain COL)
Q2G1L8 3.86e-32 121 34 6 255 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKB7 3.86e-32 121 34 6 255 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain USA300)
Q7NIW1 4.33e-32 123 34 2 222 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q9I6L0 4.38e-32 122 33 2 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q93SS1 5.03e-32 121 29 4 236 3 hmuV Hemin import ATP-binding protein HmuV Plesiomonas shigelloides
A3DDF6 5.28e-32 123 30 3 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q6LKD4 6.06e-32 123 28 3 230 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photobacterium profundum (strain SS9)
Q9KFL0 6.55e-32 120 30 3 233 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q2IYS5 6.65e-32 121 32 4 243 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain HaA2)
Q9KL34 6.65e-32 120 31 5 232 3 hmuV Hemin import ATP-binding protein HmuV Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9CM80 6.69e-32 122 30 2 220 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pasteurella multocida (strain Pm70)
P44531 7.88e-32 122 30 2 220 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q3IM24 8.89e-32 120 34 4 229 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q73XU8 9.24e-32 122 33 2 222 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q6NBX6 1.18e-31 120 28 5 248 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q3SGJ8 1.23e-31 120 31 2 229 3 phnC Phosphonates import ATP-binding protein PhnC Thiobacillus denitrificans (strain ATCC 25259)
Q0I2Z4 1.26e-31 122 30 2 222 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Histophilus somni (strain 129Pt)
Q2KDV1 1.58e-31 120 29 3 257 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q9HPH7 2.09e-31 119 34 6 223 3 VNG_1631G Putative ABC transporter ATP-binding protein VNG_1631G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q2K551 2.47e-31 119 29 5 252 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q57293 3.64e-31 120 31 2 218 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Actinobacillus pleuropneumoniae
Q0BZD8 3.92e-31 119 32 4 215 3 phnC Phosphonates import ATP-binding protein PhnC Hyphomonas neptunium (strain ATCC 15444)
Q5FA19 3.98e-31 120 33 3 226 1 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q6GKG3 4.19e-31 118 33 6 255 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain MRSA252)
Q28QF9 4.45e-31 119 29 4 247 3 hmuV Hemin import ATP-binding protein HmuV Jannaschia sp. (strain CCS1)
Q04G50 5.88e-31 120 31 3 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q7N6Z2 6.45e-31 120 31 2 226 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P56344 6.98e-31 117 33 2 222 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q8Z0H0 8.53e-31 119 31 5 246 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8UIW7 8.66e-31 118 29 3 253 3 phnC Phosphonates import ATP-binding protein PhnC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q47MA5 9.72e-31 118 30 1 233 3 hmuV Hemin import ATP-binding protein HmuV Thermobifida fusca (strain YX)
Q7W148 9.74e-31 117 34 4 234 3 phnC Phosphonates import ATP-binding protein PhnC Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q82TL6 9.92e-31 120 31 3 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q032D0 1.03e-30 117 32 4 243 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. cremoris (strain SK11)
Q1GKZ0 1.03e-30 117 30 3 250 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Ruegeria sp. (strain TM1040)
P63354 1.04e-30 119 30 2 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella suis biovar 1 (strain 1330)
P63353 1.04e-30 119 30 2 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q87SV4 1.15e-30 117 33 2 192 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q58488 1.26e-30 117 33 7 233 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8E8K8 1.27e-30 119 31 4 239 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8RGC8 1.39e-30 119 32 3 223 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q88YN5 1.47e-30 117 29 4 246 3 phnC Phosphonates import ATP-binding protein PhnC Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8ELR4 1.54e-30 119 31 5 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q7W9U5 1.71e-30 119 32 4 245 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P54537 1.93e-30 116 30 3 228 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q7VZE5 2e-30 119 32 4 245 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q55281 2.17e-30 116 31 7 237 3 mntA Manganese transport system ATP-binding protein MntA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6MCV4 2.27e-30 119 30 3 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Protochlamydia amoebophila (strain UWE25)
Q0AGF4 2.53e-30 119 32 3 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
P10346 2.63e-30 116 34 5 230 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
Q1R0Z6 2.63e-30 117 31 4 230 3 phnC Phosphonates import ATP-binding protein PhnC Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q57BC2 2.72e-30 116 33 3 223 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella abortus biovar 1 (strain 9-941)
Q2YLW6 2.72e-30 116 33 3 223 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella abortus (strain 2308)
Q31J97 3.16e-30 116 27 2 248 3 hmuV Hemin import ATP-binding protein HmuV Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q8A883 3.22e-30 120 30 2 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q9KLQ5 3.4e-30 118 29 3 227 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q03PF2 3.59e-30 118 30 4 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q7WNT8 3.9e-30 115 34 4 234 3 phnC Phosphonates import ATP-binding protein PhnC Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q5FL41 4.12e-30 118 32 5 243 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A0AGP9 4.32e-30 118 32 5 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q8DIA0 5.15e-30 117 32 2 222 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q92DL6 5.36e-30 118 32 5 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q89C51 5.37e-30 115 30 3 233 3 phnC Phosphonates import ATP-binding protein PhnC Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q5UW69 6.24e-30 115 32 3 233 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q8Y8T6 6.27e-30 117 30 4 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q39B28 6.45e-30 115 29 6 258 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8FYU9 6.56e-30 115 33 3 223 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella suis biovar 1 (strain 1330)
Q8YJ04 6.56e-30 115 33 3 223 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q03P57 7.1e-30 117 32 4 229 3 metN Methionine import ATP-binding protein MetN Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q7WGW1 7.33e-30 117 31 4 245 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q5LBT4 7.84e-30 119 30 2 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q9G4F5 7.92e-30 117 30 2 243 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q93DX8 7.99e-30 115 31 3 237 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q64SQ6 8.16e-30 119 30 2 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain YCH46)
Q1B8V9 8.24e-30 118 32 3 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain MCS)
A1UG51 8.24e-30 118 32 3 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain KMS)
Q1H0W2 8.55e-30 115 29 1 243 3 hmuV Hemin import ATP-binding protein HmuV Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q722B1 8.72e-30 117 30 4 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serotype 4b (strain F2365)
Q88CL2 9.04e-30 116 32 2 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q98FA5 9.22e-30 115 33 3 218 3 thiQ Thiamine import ATP-binding protein ThiQ Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q88AS5 1.01e-29 116 31 2 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q31DV4 1.05e-29 115 28 5 249 3 phnC Phosphonates import ATP-binding protein PhnC Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q50966 1.22e-29 117 31 3 226 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae
Q38VW6 1.6e-29 116 32 5 241 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
Q8PYH5 1.73e-29 115 33 3 227 3 MM_0887 Putative ABC transporter ATP-binding protein MM_0887 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q6RCE0 2.06e-29 114 29 6 255 3 phnC Phosphonates import ATP-binding protein PhnC Stutzerimonas stutzeri
Q8FVV5 2.3e-29 116 32 3 236 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella suis biovar 1 (strain 1330)
Q9CIQ6 2.38e-29 113 32 4 243 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. lactis (strain IL1403)
Q74K65 2.39e-29 116 32 4 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q65S66 2.5e-29 116 30 2 220 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P42360 2.64e-29 113 37 7 226 1 scaC Manganese import ATP-binding protein ScaC Streptococcus gordonii
Q10V16 2.65e-29 114 30 3 230 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Trichodesmium erythraeum (strain IMS101)
Q03EE4 3.4e-29 114 31 5 232 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q578K3 3.59e-29 115 31 3 236 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus biovar 1 (strain 9-941)
Q2YKX3 3.59e-29 115 31 3 236 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus (strain 2308)
Q72FW5 3.59e-29 115 31 4 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q49XC6 4.38e-29 113 32 4 250 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9KD30 4.67e-29 113 30 6 245 3 mntB Manganese transport system ATP-binding protein MntB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q042G7 4.92e-29 115 32 4 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q5FMM1 4.97e-29 113 33 6 248 3 phnC Phosphonates import ATP-binding protein PhnC Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q9KFN9 4.97e-29 113 30 5 252 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8XZP8 5.05e-29 115 30 2 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q4L5B3 5.54e-29 115 29 4 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus haemolyticus (strain JCSC1435)
Q9MUN1 5.97e-29 115 30 4 237 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q03AH0 6.02e-29 115 31 4 241 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q20Y31 6.26e-29 113 28 4 244 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain BisB18)
Q5HQ70 6.61e-29 115 29 3 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q0ASQ1 8.21e-29 112 32 6 233 3 phnC Phosphonates import ATP-binding protein PhnC Maricaulis maris (strain MCS10)
Q4KC87 8.8e-29 114 31 3 225 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8UH62 9.21e-29 114 29 3 237 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8DRR9 9.84e-29 112 31 5 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q2T3B8 1.09e-28 112 27 4 238 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q28VL7 1.16e-28 111 33 3 214 3 thiQ Thiamine import ATP-binding protein ThiQ Jannaschia sp. (strain CCS1)
Q89UD2 1.18e-28 114 31 3 238 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q18KE1 1.26e-28 113 30 7 253 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q1GC08 1.27e-28 112 32 6 248 3 phnC Phosphonates import ATP-binding protein PhnC Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q8DUF7 1.27e-28 114 31 5 241 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q16BJ3 1.29e-28 112 29 4 221 3 tauB Taurine import ATP-binding protein TauB Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q6NBT1 1.35e-28 114 31 2 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q6D201 1.44e-28 113 31 3 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8NSN2 1.51e-28 114 32 4 235 3 metN Methionine import ATP-binding protein MetN Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q4W575 1.52e-28 114 31 3 226 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JVH1 1.52e-28 114 31 3 226 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q97JB8 1.58e-28 112 28 5 235 3 CA_C1368 Putative ABC transporter ATP-binding protein CA_C1368 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q6D2F6 1.63e-28 114 30 4 235 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q74LQ3 1.7e-28 111 31 5 244 3 phnC Phosphonates import ATP-binding protein PhnC Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q329I3 1.71e-28 112 28 7 258 3 phnC Phosphonates import ATP-binding protein PhnC Shigella dysenteriae serotype 1 (strain Sd197)
Q046T0 1.75e-28 112 31 5 244 3 phnC Phosphonates import ATP-binding protein PhnC Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q6NJ07 1.78e-28 113 32 4 232 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A0LUE6 1.86e-28 114 33 3 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q6F9A8 1.86e-28 114 31 2 235 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q0SBZ1 1.88e-28 113 31 7 246 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhodococcus jostii (strain RHA1)
Q0B697 1.97e-28 112 28 6 258 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q8VNL9 2.01e-28 112 34 7 238 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Enterococcus faecium
Q2YKZ7 2.18e-28 113 30 4 242 3 BAB2_0493 Putative ATP-binding protein BAB2_0493 Brucella abortus (strain 2308)
Q578M5 2.18e-28 113 30 4 242 3 BruAb2_0487 Putative ATP-binding protein BruAb2_0487 Brucella abortus biovar 1 (strain 9-941)
Q8FVT0 2.27e-28 113 30 4 242 3 BRA0745 Putative ATP-binding protein BRA0745/BS1330_II0738 Brucella suis biovar 1 (strain 1330)
Q28K97 2.73e-28 111 30 4 221 3 tauB Taurine import ATP-binding protein TauB Jannaschia sp. (strain CCS1)
Q04CG8 3.01e-28 111 33 5 240 3 phnC Phosphonates import ATP-binding protein PhnC Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q8YCG3 3.12e-28 113 31 3 236 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q166X0 3.16e-28 111 28 5 258 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q035B2 3.29e-28 111 36 5 211 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q3KCC5 3.37e-28 113 30 3 227 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain Pf0-1)
Q2K8C8 3.49e-28 113 30 3 236 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q9KUI0 3.67e-28 113 31 2 235 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q326G9 3.74e-28 110 31 4 225 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella boydii serotype 4 (strain Sb227)
Q6NA00 4.22e-28 111 29 3 241 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q92V71 4.27e-28 111 29 2 232 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium meliloti (strain 1021)
Q8CMU4 4.4e-28 110 32 3 231 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HKQ8 4.4e-28 110 32 3 231 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8RHL0 4.47e-28 110 32 7 231 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q20ZP0 4.56e-28 110 30 4 243 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisB18)
Q98QH5 4.76e-28 110 31 8 244 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q07PZ0 5.16e-28 110 30 4 243 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisA53)
Q8U3E0 5.23e-28 110 32 4 223 3 PF0528 Putative ABC transporter ATP-binding protein PF0528 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q2SB47 5.6e-28 110 29 4 241 3 hmuV Hemin import ATP-binding protein HmuV Hahella chejuensis (strain KCTC 2396)
Q1MQ44 5.68e-28 112 29 3 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Lawsonia intracellularis (strain PHE/MN1-00)
Q8CPN0 5.94e-28 112 28 3 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q160G4 6.11e-28 110 27 5 247 3 hmuV Hemin import ATP-binding protein HmuV Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q926D8 6.36e-28 110 31 5 227 3 zurA Zinc uptake system ATP-binding protein ZurA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8DZJ0 6.37e-28 112 31 6 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E554 6.37e-28 112 31 6 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype III (strain NEM316)
Q3K0Y6 6.37e-28 112 31 6 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q1BJA5 6.38e-28 110 28 6 261 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia orbicola (strain AU 1054)
A0B3E2 6.38e-28 110 28 6 261 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia cenocepacia (strain HI2424)
Q7MFA1 6.51e-28 110 28 6 236 3 hmuV Hemin import ATP-binding protein HmuV Vibrio vulnificus (strain YJ016)
Q8PY27 6.66e-28 110 34 7 250 3 MM_1037 Putative ABC transporter ATP-binding protein MM_1037 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
O57872 7.08e-28 110 31 5 230 3 PH0132 Putative ABC transporter ATP-binding protein PH0132 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q3YUN6 7.09e-28 110 28 5 237 3 phnC Phosphonates import ATP-binding protein PhnC Shigella sonnei (strain Ss046)
Q7CN92 7.13e-28 112 31 5 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q99ZS8 7.13e-28 112 31 5 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M1
C3LLU1 7.34e-28 110 31 4 224 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio cholerae serotype O1 (strain M66-2)
Q9KSL1 7.34e-28 110 31 4 224 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9AB70 7.55e-28 110 30 7 253 3 phnC Phosphonates import ATP-binding protein PhnC Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9CP06 7.8e-28 112 31 3 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
Q839D4 8.11e-28 110 31 9 269 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q1GJU0 8.56e-28 110 29 6 243 3 hmuV Hemin import ATP-binding protein HmuV Ruegeria sp. (strain TM1040)
Q0SML1 8.56e-28 112 29 3 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
Q1J255 8.64e-28 110 31 5 251 3 hmuV Hemin import ATP-binding protein HmuV Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q0S0Z3 8.87e-28 111 30 7 246 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhodococcus jostii (strain RHA1)
Q0SRL2 9.02e-28 112 31 5 245 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain SM101 / Type A)
Q81Y10 1.05e-27 109 33 4 232 3 phnC Phosphonates import ATP-binding protein PhnC Bacillus anthracis
Q8U6M1 1.08e-27 111 30 3 231 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q882S0 1.11e-27 110 28 6 252 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8XIZ5 1.18e-27 111 31 5 245 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain 13 / Type A)
Q0TNZ3 1.18e-27 111 31 5 245 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q58206 1.25e-27 108 30 5 226 1 MJ0796 Uncharacterized ABC transporter ATP-binding protein MJ0796 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8FL82 1.31e-27 108 30 3 224 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q1QE80 1.33e-27 112 29 2 226 3 potA Spermidine/putrescine import ATP-binding protein PotA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q8EBC3 1.46e-27 111 31 2 235 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8REG7 1.49e-27 108 27 4 247 3 phnC Phosphonates import ATP-binding protein PhnC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
O31339 1.53e-27 111 31 3 235 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q0T9T7 1.58e-27 109 28 5 237 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8F6Z1 1.62e-27 111 30 3 226 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PE5 1.62e-27 111 30 3 226 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q83MG3 1.66e-27 108 30 4 225 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella flexneri
Q49WM4 1.82e-27 111 29 3 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q6HFB5 1.86e-27 108 33 4 232 3 phnC Phosphonates import ATP-binding protein PhnC Bacillus thuringiensis subsp. konkukian (strain 97-27)
P16677 2.01e-27 108 28 5 237 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain K12)
O27739 2.13e-27 110 32 6 230 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q110U3 2.15e-27 111 30 2 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichodesmium erythraeum (strain IMS101)
Q50801 2.31e-27 109 32 7 234 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q637E2 2.34e-27 108 33 4 232 3 phnC Phosphonates import ATP-binding protein PhnC Bacillus cereus (strain ZK / E33L)
Q1J6Q6 2.51e-27 111 31 5 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGY7 2.51e-27 111 31 5 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JLT7 2.51e-27 111 31 5 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBV6 2.51e-27 111 31 5 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q830W6 2.68e-27 110 30 4 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q9XDA6 2.72e-27 108 32 5 227 3 zurA Zinc uptake system ATP-binding protein ZurA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
A0PXX7 2.73e-27 109 32 7 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium novyi (strain NT)
Q5PCG9 2.75e-27 110 28 4 244 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZPK4 2.85e-27 111 29 3 231 1 osmV Osmoprotectant import ATP-binding protein OsmV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q62K82 2.89e-27 110 31 3 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q8D3S8 2.96e-27 108 28 6 236 3 hmuV Hemin import ATP-binding protein HmuV Vibrio vulnificus (strain CMCP6)
Q6N999 2.99e-27 107 32 5 225 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q63TY1 3.02e-27 110 31 3 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q7N8V0 3.14e-27 107 30 3 230 3 thiQ Thiamine import ATP-binding protein ThiQ Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q81GU1 3.24e-27 110 30 3 237 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8TIX0 3.34e-27 109 29 3 227 3 MA_4020 Putative ABC transporter ATP-binding protein MA_4020 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q5LVM5 3.35e-27 108 29 4 221 3 tauB Taurine import ATP-binding protein TauB Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q18AM3 3.48e-27 110 31 3 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridioides difficile (strain 630)
Q660M8 3.48e-27 110 30 4 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
O51587 3.78e-27 110 30 4 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q5XCA4 4.06e-27 110 30 5 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q7NWX3 4.22e-27 110 29 2 225 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P0CZ35 4.27e-27 110 30 5 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TP4 4.27e-27 110 30 5 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M28 (strain MGAS6180)
P0CZ34 4.27e-27 110 30 5 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
A3CMQ7 4.37e-27 110 31 6 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus sanguinis (strain SK36)
Q57S53 4.38e-27 109 28 4 244 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q32K28 4.52e-27 107 30 4 225 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella dysenteriae serotype 1 (strain Sd197)
Q0T8D1 4.61e-27 107 32 3 203 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella flexneri serotype 5b (strain 8401)
Q8XA06 4.81e-27 107 30 4 226 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O157:H7
Q30V33 4.9e-27 110 30 2 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q1LC89 5.21e-27 107 27 3 235 3 hmuV Hemin import ATP-binding protein HmuV Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
O28882 5.27e-27 107 31 3 234 3 livF Probable branched-chain amino acid transport ATP-binding protein LivF Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q63NR0 5.31e-27 108 28 4 239 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia pseudomallei (strain K96243)
Q3JHM1 5.31e-27 108 28 4 239 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia pseudomallei (strain 1710b)
Q62A98 5.31e-27 108 28 4 239 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia mallei (strain ATCC 23344)
Q5LVC2 5.36e-27 108 30 2 232 3 phnC Phosphonates import ATP-binding protein PhnC Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q8TQ05 5.56e-27 112 30 5 226 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQ05 3.72e-18 86 30 5 222 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q9HYL7 6.38e-27 108 29 7 255 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HMZ4 6.47e-27 107 30 5 230 3 VNG_2317G Putative ABC transporter ATP-binding protein VNG_2317G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q1RGD0 6.53e-27 107 29 3 224 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli (strain UTI89 / UPEC)
Q48HL2 6.59e-27 108 28 7 252 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q839D5 6.64e-27 108 31 6 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q1DCP5 6.77e-27 107 28 4 250 3 hmuV Hemin import ATP-binding protein HmuV Myxococcus xanthus (strain DK1622)
Q1R3F6 6.92e-27 107 28 5 237 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain UTI89 / UPEC)
Q6F0P3 6.96e-27 107 31 5 248 3 phnC Phosphonates import ATP-binding protein PhnC Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q1J982 7.15e-27 108 31 5 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q92WJ0 7.16e-27 109 31 3 231 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhizobium meliloti (strain 1021)
Q73F66 8.53e-27 108 31 8 253 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q7NX01 8.54e-27 109 31 2 224 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q6LX68 8.55e-27 107 32 6 229 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q0TLS2 8.78e-27 106 29 3 224 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8PZN0 8.87e-27 110 31 7 232 3 MM_0462 Putative ABC transporter ATP-binding protein MM_0462 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q4A5A5 9.08e-27 107 29 5 237 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis synoviae (strain 53)
Q02QM1 9.1e-27 107 29 7 255 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q65UE1 9.83e-27 109 32 3 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q668K6 9.97e-27 109 28 2 247 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q82WT5 1.01e-26 109 32 2 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q5ZWE4 1.08e-26 109 29 2 226 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q67JX3 1.08e-26 107 31 7 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q6D3Q6 1.1e-26 108 30 3 223 3 metN2 Methionine import ATP-binding protein MetN 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6KHL1 1.15e-26 107 32 6 242 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
P0C0E9 1.19e-26 107 31 5 229 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Streptococcus pyogenes
P0CZ29 1.19e-26 107 31 5 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RH11 1.19e-26 107 31 5 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J449 1.19e-26 107 31 5 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC8 1.19e-26 107 31 5 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q7CMM7 1.19e-26 107 31 5 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B5 1.19e-26 107 31 5 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ28 1.19e-26 107 31 5 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8DPC2 1.21e-26 109 31 6 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q42 1.21e-26 109 31 6 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JW0 1.21e-26 109 31 6 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q0SWH9 1.22e-26 107 31 6 233 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain SM101 / Type A)
Q733D6 1.23e-26 107 32 4 232 3 phnC Phosphonates import ATP-binding protein PhnC Bacillus cereus (strain ATCC 10987 / NRS 248)
Q48QM2 1.27e-26 107 31 5 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JJC9 1.27e-26 107 31 5 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
P0C0E8 1.27e-26 107 31 5 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M1
Q0RYP7 1.39e-26 108 30 7 246 3 fbpC3 Fe(3+) ions import ATP-binding protein FbpC 3 Rhodococcus jostii (strain RHA1)
Q8FAV1 1.4e-26 107 28 5 235 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q2JPW6 1.41e-26 107 30 3 199 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q31TP8 1.44e-26 106 28 5 237 3 phnC Phosphonates import ATP-binding protein PhnC Shigella boydii serotype 4 (strain Sb227)
Q4L9P7 1.46e-26 106 31 4 242 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus haemolyticus (strain JCSC1435)
Q73P71 1.5e-26 106 30 4 243 3 phnC Phosphonates import ATP-binding protein PhnC Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q4ZU82 1.55e-26 107 28 7 252 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. syringae (strain B728a)
Q8XNY7 1.63e-26 107 31 6 230 3 CPE0195 Putative ABC transporter ATP-binding protein CPE0195 Clostridium perfringens (strain 13 / Type A)
Q8YUV1 1.69e-26 106 31 5 234 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9X196 1.75e-26 108 32 3 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P45171 1.79e-26 108 31 3 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8ZR89 1.84e-26 108 28 4 244 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H2ZLL3 2.02e-26 105 29 3 238 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8A1M1 2.11e-26 105 32 3 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q5LI72 2.24e-26 105 31 3 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
P44785 2.27e-26 108 32 5 232 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CIS8 2.39e-26 107 32 7 237 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. lactis (strain IL1403)
Q6D0F3 2.45e-26 105 30 3 223 3 thiQ Thiamine import ATP-binding protein ThiQ Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q032H4 2.51e-26 106 31 6 243 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain SK11)
A2RI01 2.51e-26 106 31 6 243 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain MG1363)
Q64Z80 2.54e-26 105 31 3 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bacteroides fragilis (strain YCH46)
Q8U4L3 2.57e-26 106 28 5 242 3 PF0068 Putative ABC transporter ATP-binding protein PF0068 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q8FRX8 2.65e-26 108 31 3 219 3 metN Methionine import ATP-binding protein MetN Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8EEV5 2.7e-26 105 31 5 223 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0TUN8 2.72e-26 106 31 6 233 1 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8EPK1 2.8e-26 107 30 4 248 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
O29527 2.98e-26 106 28 3 221 3 AF_0731 Putative ABC transporter ATP-binding protein AF_0731 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q5WXF0 3e-26 108 29 2 226 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q7NQN5 3.15e-26 107 29 4 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1B677 3.29e-26 107 30 3 228 3 metN Methionine import ATP-binding protein MetN Mycobacterium sp. (strain MCS)
A5F1V0 3.3e-26 105 30 5 227 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9K8N1 3.55e-26 105 31 4 258 3 phnC3 Phosphonates import ATP-binding protein PhnC 3 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q3Z5U5 3.76e-26 105 30 4 225 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella sonnei (strain Ss046)
Q4QMH4 3.84e-26 107 31 5 232 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain 86-028NP)
Q8TK65 3.9e-26 108 32 7 232 3 MA_3551 Putative ABC transporter ATP-binding protein MA_3551 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q30W28 3.98e-26 105 27 4 251 3 phnC Phosphonates import ATP-binding protein PhnC Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q9KP42 4.12e-26 105 30 3 214 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q035E0 4.29e-26 105 30 6 261 3 phnC Phosphonates import ATP-binding protein PhnC Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q8Z5N5 4.35e-26 105 28 3 229 3 cbiO Cobalt import ATP-binding protein CbiO Salmonella typhi
Q890R2 4.39e-26 105 31 5 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium tetani (strain Massachusetts / E88)
Q5PDU4 4.63e-26 105 28 3 229 3 cbiO Cobalt import ATP-binding protein CbiO Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8D0W8 5.03e-26 107 27 2 247 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pestis
Q0SFW6 5.42e-26 107 32 5 227 3 metN2 Methionine import ATP-binding protein MetN 2 Rhodococcus jostii (strain RHA1)
O26236 5.47e-26 105 31 7 234 3 MTH_133 Putative ABC transporter ATP-binding protein MTH_133 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8XDV7 5.75e-26 105 28 5 237 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O157:H7
Q8ESM5 5.75e-26 105 32 4 243 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9PPV1 5.9e-26 105 32 5 222 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ureaplasma parvum serovar 3 (strain ATCC 700970)
O34362 5.91e-26 108 27 4 229 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
O34362 2.53e-14 75 25 7 238 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
Q5LYN4 5.99e-26 107 29 4 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain CNRZ 1066)
Q9KS33 6e-26 107 30 3 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5M397 6.17e-26 107 29 4 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5X627 6.19e-26 107 29 2 226 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q2SJY7 6.21e-26 107 30 2 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Hahella chejuensis (strain KCTC 2396)
Q83P97 6.38e-26 105 28 5 235 3 phnC Phosphonates import ATP-binding protein PhnC Shigella flexneri
Q0SXV5 6.38e-26 105 28 5 235 3 phnC Phosphonates import ATP-binding protein PhnC Shigella flexneri serotype 5b (strain 8401)
Q03JH1 6.7e-26 107 29 4 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q6D664 7.09e-26 104 33 6 226 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q14Q07 7.19e-26 106 31 2 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Spiroplasma citri
Q65P77 7.62e-26 105 30 6 243 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q24XJ2 7.82e-26 106 32 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Desulfitobacterium hafniense (strain Y51)
Q20ZS6 8.1e-26 103 30 4 223 3 lolD2 Lipoprotein-releasing system ATP-binding protein LolD 2 Rhodopseudomonas palustris (strain BisB18)
Q4QK57 8.54e-26 107 30 3 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q609Q1 9.31e-26 106 30 2 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q81GC1 1.01e-25 105 29 2 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8TTN2 1.01e-25 107 28 5 232 3 MA_0394 Putative ABC transporter ATP-binding protein MA_0394 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8G5P8 1.01e-25 107 30 5 226 3 metN Methionine import ATP-binding protein MetN Bifidobacterium longum (strain NCC 2705)
Q81TH8 1.03e-25 105 29 3 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus anthracis
Q63E84 1.06e-25 105 29 3 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ZK / E33L)
Q73BM0 1.06e-25 105 29 3 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RBB0 1.06e-25 105 29 3 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis (strain Al Hakam)
O86751 1.11e-25 106 28 3 227 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q6HLQ9 1.19e-25 105 29 3 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis subsp. konkukian (strain 97-27)
P31548 1.2e-25 103 30 4 226 1 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli (strain K12)
Q9CGD4 1.3e-25 107 31 4 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. lactis (strain IL1403)
Q2FNX9 1.31e-25 104 29 6 242 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q8DWR3 1.41e-25 104 32 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L2 1.41e-25 104 32 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF4 1.41e-25 104 32 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q66EN1 1.45e-25 103 31 3 224 3 thiQ Thiamine import ATP-binding protein ThiQ Yersinia pseudotuberculosis serotype I (strain IP32953)
Q6XYZ3 1.53e-25 105 31 7 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Spiroplasma kunkelii
Q6LQ00 1.54e-25 107 32 4 201 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q6LQ00 1e-17 85 29 9 255 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q65VG9 1.58e-25 105 32 6 239 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q88ZZ2 1.6e-25 107 30 2 210 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88ZZ2 4.64e-12 68 26 8 246 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q4QLQ1 1.64e-25 102 33 2 202 3 thiQ Thiamine import ATP-binding protein ThiQ Haemophilus influenzae (strain 86-028NP)
O85818 1.69e-25 106 31 3 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
Q3ICT8 1.71e-25 103 27 4 246 3 hmuV Hemin import ATP-binding protein HmuV Pseudoalteromonas translucida (strain TAC 125)
A3CVD3 1.77e-25 104 28 5 239 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q88ZJ6 1.87e-25 105 28 3 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q81A96 1.94e-25 103 32 4 228 3 phnC Phosphonates import ATP-binding protein PhnC Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6F9P2 1.95e-25 105 32 5 240 3 metN2 Methionine import ATP-binding protein MetN 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q6HPM9 1.99e-25 104 31 8 253 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ1 1.99e-25 104 31 8 253 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus anthracis
A1TXH7 2e-25 105 27 2 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q8TQW9 2.08e-25 107 31 4 221 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQW9 4.06e-14 74 28 7 232 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
A2RI02 2.08e-25 104 31 7 237 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain MG1363)
Q8RI39 2.1e-25 105 31 4 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q05596 2.1e-25 103 28 3 229 1 cbiO Cobalt import ATP-binding protein CbiO Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q02Z10 2.15e-25 106 31 4 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. cremoris (strain SK11)
Q03Z27 2.16e-25 105 29 4 236 3 metN Methionine import ATP-binding protein MetN Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
A0R8K9 2.21e-25 104 31 8 253 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis (strain Al Hakam)
Q2YAD6 2.21e-25 105 30 3 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q6LV32 2.24e-25 103 31 3 200 3 thiQ Thiamine import ATP-binding protein ThiQ Photobacterium profundum (strain SS9)
Q2IF17 2.26e-25 103 32 4 226 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Anaeromyxobacter dehalogenans (strain 2CP-C)
Q8PSR0 2.44e-25 107 29 5 229 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PSR0 7.5e-21 94 30 5 222 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q2K6L3 2.48e-25 105 29 5 253 3 ugpC1 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q98GF5 2.56e-25 103 27 2 236 3 phnC Phosphonates import ATP-binding protein PhnC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1WVI7 2.6e-25 105 30 6 245 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
Q7MPC5 2.72e-25 102 29 4 208 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio vulnificus (strain YJ016)
Q8DE95 2.72e-25 102 29 4 208 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio vulnificus (strain CMCP6)
Q8PUE7 2.89e-25 107 32 3 215 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 8.21e-11 65 28 9 232 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8TI16 2.96e-25 103 32 7 250 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q6MIP7 3.03e-25 103 27 3 234 3 phnC Phosphonates import ATP-binding protein PhnC Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q92VJ2 3.14e-25 105 29 4 225 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q63JZ3 3.33e-25 103 30 4 233 3 tauB Taurine import ATP-binding protein TauB Burkholderia pseudomallei (strain K96243)
Q74L62 3.34e-25 103 29 6 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q1MCN6 3.49e-25 105 30 3 239 3 ugpC1 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14635
Feature type CDS
Gene -
Product ATP-binding cassette domain-containing protein
Location 3243069 - 3243824 (strand: 1)
Length 756 (nucleotides) / 251 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_688
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4604 Inorganic ion transport and metabolism (P) P ABC-type enterochelin transport system, ATPase component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K25285 iron-siderophore transport system ATP-binding protein [EC:7.2.2.-] - -

Protein Sequence

MIEISKISKRYQDTTVLDNITTTIQRGGITSIIGPNGAGKSTLLSVIGRLLMPESGMVSVNGMDVAATESDVLAKNLSILRQENQFVSRLTVEELVGFGRYPYSKGRLTLEDKKVIDESLDFLNLTEFRHRYLDELSGGQRQRTYVAMVLCQDTEYVMLDEPLNNLDMKHAVIMMKLLRKAADELGKTIIIVIHDINFASVYSDYILAMRNGQLYYHGSPKEIMKSDIIEDIFDTPVDVKELDDKLIAMYY

Flanking regions ( +/- flanking 50bp)

GTTTATTGGTGGTATGTTCTTTATTTATTTGGTATTAAGAAGACTTTAATATGATTGAAATCAGTAAGATATCAAAACGTTATCAAGACACAACAGTGCTCGATAATATTACAACAACCATTCAACGTGGCGGTATTACTTCAATCATCGGACCCAATGGTGCGGGTAAATCCACCTTACTTTCTGTAATAGGCCGTCTACTGATGCCAGAAAGCGGTATGGTCAGTGTGAATGGCATGGATGTTGCGGCCACAGAGAGTGATGTATTAGCCAAAAACCTTTCCATACTACGCCAAGAAAATCAGTTTGTGAGTCGCTTAACTGTTGAAGAGTTAGTCGGTTTTGGTCGCTACCCTTATAGTAAAGGACGCTTAACGCTAGAAGATAAGAAAGTGATTGATGAATCACTCGATTTTCTTAATTTGACTGAATTTCGTCACCGTTATCTTGATGAATTATCCGGTGGGCAACGCCAGCGTACTTATGTTGCAATGGTATTATGTCAAGATACTGAATACGTGATGCTTGATGAACCGCTTAACAATCTTGATATGAAACACGCGGTCATTATGATGAAATTACTGCGTAAAGCCGCCGATGAGCTAGGAAAAACCATTATCATCGTCATTCATGATATCAATTTCGCCTCTGTGTATTCCGACTACATTTTAGCCATGCGCAACGGGCAACTTTACTATCATGGCTCACCTAAAGAGATCATGAAATCCGATATTATCGAAGATATTTTCGATACTCCCGTCGACGTTAAAGAGTTGGATGATAAGCTTATCGCGATGTATTACTAATATTGCTATTTCACCGAAAGCCAAACAGCATATTGTTACTTTTAAACAAT