Homologs in group_2172

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16340 FBDBKF_16340 100.0 Morganella morganii S1 secB protein-export chaperone SecB
EHELCC_16375 EHELCC_16375 100.0 Morganella morganii S2 secB protein-export chaperone SecB
NLDBIP_16965 NLDBIP_16965 100.0 Morganella morganii S4 secB protein-export chaperone SecB
LHKJJB_16885 LHKJJB_16885 100.0 Morganella morganii S3 secB protein-export chaperone SecB
F4V73_RS17240 F4V73_RS17240 95.5 Morganella psychrotolerans secB protein-export chaperone SecB
PMI_RS15740 PMI_RS15740 82.8 Proteus mirabilis HI4320 secB protein-export chaperone SecB

Distribution of the homologs in the orthogroup group_2172

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2172

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
C6DIA3 1.48e-95 275 84 0 150 3 secB Protein-export protein SecB Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5BC34 2.98e-95 275 83 1 157 3 secB Protein-export protein SecB Edwardsiella ictaluri (strain 93-146)
Q7CPH8 5.05e-95 274 81 1 156 3 secB Protein-export protein SecB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGG5 5.05e-95 274 81 1 156 3 secB Protein-export protein SecB Salmonella typhi
B4TZV2 5.05e-95 274 81 1 156 3 secB Protein-export protein SecB Salmonella schwarzengrund (strain CVM19633)
B5BHY4 5.05e-95 274 81 1 156 3 secB Protein-export protein SecB Salmonella paratyphi A (strain AKU_12601)
C0Q1U3 5.05e-95 274 81 1 156 3 secB Protein-export protein SecB Salmonella paratyphi C (strain RKS4594)
A9MVK3 5.05e-95 274 81 1 156 3 secB Protein-export protein SecB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PBZ5 5.05e-95 274 81 1 156 3 secB Protein-export protein SecB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SXB2 5.05e-95 274 81 1 156 3 secB Protein-export protein SecB Salmonella newport (strain SL254)
B4T994 5.05e-95 274 81 1 156 3 secB Protein-export protein SecB Salmonella heidelberg (strain SL476)
B5RGH7 5.05e-95 274 81 1 156 3 secB Protein-export protein SecB Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5D4 5.05e-95 274 81 1 156 3 secB Protein-export protein SecB Salmonella enteritidis PT4 (strain P125109)
B5FLH9 5.05e-95 274 81 1 156 3 secB Protein-export protein SecB Salmonella dublin (strain CT_02021853)
Q57ID2 5.05e-95 274 81 1 156 3 secB Protein-export protein SecB Salmonella choleraesuis (strain SC-B67)
A9MKR5 5.05e-95 274 81 1 156 3 secB Protein-export protein SecB Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5EXB6 5.05e-95 274 81 1 156 3 secB Protein-export protein SecB Salmonella agona (strain SL483)
A8ARJ6 1.3e-94 273 81 1 156 3 secB Protein-export protein SecB Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4W536 1.6e-94 273 81 1 156 3 secB Protein-export protein SecB Enterobacter sp. (strain 638)
Q329P5 1.73e-94 273 81 1 156 3 secB Protein-export protein SecB Shigella dysenteriae serotype 1 (strain Sd197)
Q1R4Y5 1.73e-94 273 81 1 156 3 secB Protein-export protein SecB Escherichia coli (strain UTI89 / UPEC)
B6I3I8 1.73e-94 273 81 1 156 3 secB Protein-export protein SecB Escherichia coli (strain SE11)
B1IZI1 1.73e-94 273 81 1 156 3 secB Protein-export protein SecB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TBJ7 1.73e-94 273 81 1 156 3 secB Protein-export protein SecB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AHE6 1.73e-94 273 81 1 156 3 secB Protein-export protein SecB Escherichia coli O1:K1 / APEC
B7N255 1.73e-94 273 81 1 156 3 secB Protein-export protein SecB Escherichia coli O81 (strain ED1a)
B7MFH3 1.73e-94 273 81 1 156 3 secB Protein-export protein SecB Escherichia coli O45:K1 (strain S88 / ExPEC)
B7ULG5 1.73e-94 273 81 1 156 3 secB Protein-export protein SecB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7LTL6 2.01e-94 273 81 1 156 3 secB Protein-export protein SecB Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8KRM2 2.25e-94 273 83 0 150 3 secB Protein-export protein SecB Serratia marcescens
B2VL52 2.39e-94 272 82 1 153 3 secB Protein-export protein SecB Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6DAT1 2.54e-94 272 86 0 144 3 secB Protein-export protein SecB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P0AG89 3.89e-94 272 80 1 156 3 secB Protein-export protein SecB Shigella flexneri
Q0SYD5 3.89e-94 272 80 1 156 3 secB Protein-export protein SecB Shigella flexneri serotype 5b (strain 8401)
Q31V12 3.89e-94 272 80 1 156 3 secB Protein-export protein SecB Shigella boydii serotype 4 (strain Sb227)
B2U5C8 3.89e-94 272 80 1 156 3 secB Protein-export protein SecB Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LK48 3.89e-94 272 80 1 156 3 secB Protein-export protein SecB Escherichia coli (strain SMS-3-5 / SECEC)
B7NER6 3.89e-94 272 80 1 156 3 secB Protein-export protein SecB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AG86 3.89e-94 272 80 1 156 1 secB Protein-export protein SecB Escherichia coli (strain K12)
P0AG87 3.89e-94 272 80 1 156 3 secB Protein-export protein SecB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A674 3.89e-94 272 80 1 156 3 secB Protein-export protein SecB Escherichia coli O9:H4 (strain HS)
B1X943 3.89e-94 272 80 1 156 3 secB Protein-export protein SecB Escherichia coli (strain K12 / DH10B)
C4ZXK1 3.89e-94 272 80 1 156 3 secB Protein-export protein SecB Escherichia coli (strain K12 / MC4100 / BW2952)
B7M496 3.89e-94 272 80 1 156 3 secB Protein-export protein SecB Escherichia coli O8 (strain IAI1)
B7NPB8 3.89e-94 272 80 1 156 3 secB Protein-export protein SecB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YWB1 3.89e-94 272 80 1 156 3 secB Protein-export protein SecB Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AG88 3.89e-94 272 80 1 156 3 secB Protein-export protein SecB Escherichia coli O157:H7
B7L735 3.89e-94 272 80 1 156 3 secB Protein-export protein SecB Escherichia coli (strain 55989 / EAEC)
A7ZTG3 3.89e-94 272 80 1 156 3 secB Protein-export protein SecB Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7MY53 9.08e-94 271 81 1 158 3 secB Protein-export protein SecB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3YVX4 9.55e-94 271 80 1 156 3 secB Protein-export protein SecB Shigella sonnei (strain Ss046)
A1JHY4 1.97e-93 270 80 0 152 3 secB Protein-export protein SecB Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B4F139 3.77e-93 270 82 0 157 3 secB Protein-export protein SecB Proteus mirabilis (strain HI4320)
B1JQV6 4.91e-93 269 84 0 144 3 secB Protein-export protein SecB Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66GB9 4.91e-93 269 84 0 144 3 secB Protein-export protein SecB Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TSB9 4.91e-93 269 84 0 144 3 secB Protein-export protein SecB Yersinia pestis (strain Pestoides F)
Q1CD20 4.91e-93 269 84 0 144 3 secB Protein-export protein SecB Yersinia pestis bv. Antiqua (strain Nepal516)
A9R690 4.91e-93 269 84 0 144 3 secB Protein-export protein SecB Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJM7 4.91e-93 269 84 0 144 3 secB Protein-export protein SecB Yersinia pestis
B2JYQ0 4.91e-93 269 84 0 144 3 secB Protein-export protein SecB Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C285 4.91e-93 269 84 0 144 3 secB Protein-export protein SecB Yersinia pestis bv. Antiqua (strain Antiqua)
A7FCV1 4.91e-93 269 84 0 144 3 secB Protein-export protein SecB Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GLB9 7.2e-93 269 81 0 150 3 secB Protein-export protein SecB Serratia proteamaculans (strain 568)
A7MID6 2.33e-91 265 81 0 149 3 secB Protein-export protein SecB Cronobacter sakazakii (strain ATCC BAA-894)
A6TFK4 9.17e-91 263 80 0 152 3 secB Protein-export protein SecB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XTJ1 9.17e-91 263 80 0 152 3 secB Protein-export protein SecB Klebsiella pneumoniae (strain 342)
Q2NQW5 6.32e-90 261 77 1 156 3 secB Protein-export protein SecB Sodalis glossinidius (strain morsitans)
A1S1L8 8.15e-80 236 71 2 160 3 secB Protein-export protein SecB Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8HAD8 8.6e-78 231 74 1 148 3 secB Protein-export protein SecB Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A1RQ93 1.26e-77 230 74 1 148 3 secB Protein-export protein SecB Shewanella sp. (strain W3-18-1)
A4Y1E5 1.26e-77 230 74 1 148 3 secB Protein-export protein SecB Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B8CGT2 5.07e-77 229 73 1 148 3 secB Protein-export protein SecB Shewanella piezotolerans (strain WP3 / JCM 13877)
A8G1U7 8.04e-77 228 75 1 144 3 secB Protein-export protein SecB Shewanella sediminis (strain HAW-EB3)
A9KUC0 8.78e-77 228 73 1 148 3 secB Protein-export protein SecB Shewanella baltica (strain OS195)
A6WHC9 8.78e-77 228 73 1 148 3 secB Protein-export protein SecB Shewanella baltica (strain OS185)
B8E3F6 8.78e-77 228 73 1 148 3 secB Protein-export protein SecB Shewanella baltica (strain OS223)
A3QJM2 2.68e-76 227 75 1 144 3 secB Protein-export protein SecB Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q07VX0 4.29e-76 226 70 1 148 3 secB Protein-export protein SecB Shewanella frigidimarina (strain NCIMB 400)
A3DAM8 5.84e-76 226 72 1 148 3 secB Protein-export protein SecB Shewanella baltica (strain OS155 / ATCC BAA-1091)
B1KQ11 6.31e-76 226 74 1 144 3 secB Protein-export protein SecB Shewanella woodyi (strain ATCC 51908 / MS32)
Q12HV7 1.55e-75 225 76 0 136 3 secB Protein-export protein SecB Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q3IIE1 1.95e-75 225 70 0 144 3 secB Protein-export protein SecB Pseudoalteromonas translucida (strain TAC 125)
B0TLE8 6.09e-75 223 76 1 140 3 secB Protein-export protein SecB Shewanella halifaxensis (strain HAW-EB4)
Q8EKP0 7.66e-75 223 76 1 140 3 secB Protein-export protein SecB Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0I0Q4 2.4e-74 222 75 1 140 3 secB Protein-export protein SecB Shewanella sp. (strain MR-7)
Q0HP89 4.1e-74 221 75 1 140 3 secB Protein-export protein SecB Shewanella sp. (strain MR-4)
A0KR79 4.1e-74 221 75 1 140 3 secB Protein-export protein SecB Shewanella sp. (strain ANA-3)
Q6LVL0 3.01e-73 219 66 2 159 3 secB Protein-export protein SecB Photobacterium profundum (strain SS9)
B4S0I7 1.39e-71 215 68 0 137 3 secB Protein-export protein SecB Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
C4LA08 1.62e-71 215 64 1 152 3 secB Protein-export protein SecB Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A1SZI0 4.25e-71 214 64 1 151 3 secB Protein-export protein SecB Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B5FBT9 9.68e-71 213 71 0 136 3 secB Protein-export protein SecB Aliivibrio fischeri (strain MJ11)
Q5E2A2 9.68e-71 213 71 0 136 3 secB Protein-export protein SecB Aliivibrio fischeri (strain ATCC 700601 / ES114)
C4K4M5 1.34e-70 213 62 0 148 3 secB Protein-export protein SecB Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B7VHM6 1.57e-70 212 68 0 138 3 secB Protein-export protein SecB Vibrio atlanticus (strain LGP32)
B6EN68 1.64e-70 212 69 1 142 3 secB Protein-export protein SecB Aliivibrio salmonicida (strain LFI1238)
Q7MGY8 2.62e-70 211 69 0 137 3 secB Protein-export protein SecB Vibrio vulnificus (strain YJ016)
Q8DCW3 2.62e-70 211 69 0 137 3 secB Protein-export protein SecB Vibrio vulnificus (strain CMCP6)
A7MX74 8.47e-70 210 70 0 137 3 secB Protein-export protein SecB Vibrio campbellii (strain ATCC BAA-1116)
C3LRW4 1.3e-69 210 71 0 135 3 secB Protein-export protein SecB Vibrio cholerae serotype O1 (strain M66-2)
Q9KNS8 1.3e-69 210 71 0 135 3 secB Protein-export protein SecB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4Y6 1.3e-69 210 71 0 135 3 secB Protein-export protein SecB Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87KZ3 2.34e-69 209 69 0 137 3 secB Protein-export protein SecB Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A0KF07 6.71e-69 208 69 0 133 3 secB Protein-export protein SecB Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q47VY5 1.06e-68 208 62 0 145 3 secB Protein-export protein SecB Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A4ST21 2.24e-68 207 69 0 133 3 secB Protein-export protein SecB Aeromonas salmonicida (strain A449)
Q15PS2 3.89e-67 204 68 0 134 3 secB Protein-export protein SecB Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B0BRA2 1.71e-66 202 58 1 151 3 secB Protein-export protein SecB Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GYJ0 1.71e-66 202 58 1 151 3 secB Protein-export protein SecB Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N2F7 1.93e-66 202 58 1 151 3 secB Protein-export protein SecB Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0UUY0 1.99e-66 202 60 1 149 3 secB Protein-export protein SecB Histophilus somni (strain 2336)
Q0I0W6 1.99e-66 202 60 1 149 3 secB Protein-export protein SecB Histophilus somni (strain 129Pt)
Q7VN99 4.8e-65 199 59 1 142 3 secB Protein-export protein SecB Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q65QD9 5.48e-65 199 60 1 146 3 secB Protein-export protein SecB Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B8F6T7 7.66e-64 196 54 1 155 3 secB Protein-export protein SecB Glaesserella parasuis serovar 5 (strain SH0165)
P44853 2.36e-61 189 59 1 135 1 secB Protein-export protein SecB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QMF4 2.36e-61 189 59 1 135 3 secB Protein-export protein SecB Haemophilus influenzae (strain 86-028NP)
A5UHP8 2.44e-61 189 59 1 135 3 secB Protein-export protein SecB Haemophilus influenzae (strain PittGG)
Q5ZT57 2.45e-61 189 56 0 153 3 secB Protein-export protein SecB Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q9CL16 5.79e-61 188 60 1 133 3 secB Protein-export protein SecB Pasteurella multocida (strain Pm70)
A5UDY2 1.3e-60 187 58 1 135 3 secB Protein-export protein SecB Haemophilus influenzae (strain PittEE)
Q5QZA7 8.56e-60 185 58 1 141 3 secB Protein-export protein SecB Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q491X9 1.96e-59 184 55 0 142 3 secB Protein-export protein SecB Blochmanniella pennsylvanica (strain BPEN)
C3K7C1 4.45e-59 183 54 1 153 3 secB Protein-export protein SecB Pseudomonas fluorescens (strain SBW25)
Q93TF4 1.15e-58 182 52 1 157 3 secB Protein-export protein SecB Pseudomonas fluorescens
A1U5G9 1.79e-58 182 54 1 144 3 secB Protein-export protein SecB Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A6VLB7 3.03e-58 181 53 1 151 3 secB Protein-export protein SecB Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B8D6W5 6.3e-58 180 50 0 142 3 secB Protein-export protein SecB Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57161 6.3e-58 180 50 0 142 3 secB Protein-export protein SecB Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8L1 6.3e-58 180 50 0 142 3 secB Protein-export protein SecB Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q3KJH6 1.18e-57 180 53 1 153 3 secB Protein-export protein SecB Pseudomonas fluorescens (strain Pf0-1)
A4VRU9 1.88e-57 179 56 1 143 3 secB Protein-export protein SecB Stutzerimonas stutzeri (strain A1501)
A4Y074 9.03e-57 177 55 1 145 3 secB Protein-export protein SecB Pseudomonas mendocina (strain ymp)
Q4KJR5 1.11e-56 177 52 2 160 3 secB Protein-export protein SecB Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q87UH3 2.11e-56 177 58 0 136 3 secB Protein-export protein SecB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q5WUE1 3.17e-56 176 56 0 153 3 secB Protein-export protein SecB Legionella pneumophila (strain Lens)
A5IEA6 3.17e-56 176 56 0 153 3 secB Protein-export protein SecB Legionella pneumophila (strain Corby)
Q5X2Y1 3.17e-56 176 56 0 153 3 secB Protein-export protein SecB Legionella pneumophila (strain Paris)
Q4ZLR3 5.19e-56 176 57 0 136 3 secB Protein-export protein SecB Pseudomonas syringae pv. syringae (strain B728a)
Q48C90 6.31e-56 176 57 0 136 3 secB Protein-export protein SecB Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
P32002 1.34e-55 174 49 0 153 3 secB Protein-export protein SecB Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q2SMA3 5.34e-55 173 59 0 127 3 secB Protein-export protein SecB Hahella chejuensis (strain KCTC 2396)
Q1IG59 1.14e-53 170 49 1 152 3 secB Protein-export protein SecB Pseudomonas entomophila (strain L48)
B1J2T8 2.37e-53 169 52 0 136 3 secB Protein-export protein SecB Pseudomonas putida (strain W619)
Q88CX7 2.58e-53 169 52 0 136 3 secB Protein-export protein SecB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WA86 2.58e-53 169 52 0 136 3 secB Protein-export protein SecB Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1R1J5 4.07e-53 168 50 2 151 3 secB Protein-export protein SecB Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B0KN08 4.76e-53 168 52 0 136 3 secB Protein-export protein SecB Pseudomonas putida (strain GB-1)
Q9HU56 1.37e-52 167 53 2 143 3 secB Protein-export protein SecB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02EN8 1.37e-52 167 53 2 143 3 secB Protein-export protein SecB Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3M1 1.37e-52 167 53 2 143 3 secB Protein-export protein SecB Pseudomonas aeruginosa (strain LESB58)
A6VDP6 1.37e-52 167 53 2 143 3 secB Protein-export protein SecB Pseudomonas aeruginosa (strain PA7)
C1DJD9 6.83e-52 165 53 1 139 3 secB Protein-export protein SecB Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q31E80 1.6e-51 164 52 1 144 3 secB Protein-export protein SecB Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A6VT70 1.92e-51 164 51 0 135 3 secB Protein-export protein SecB Marinomonas sp. (strain MWYL1)
Q7NYZ5 1.26e-49 159 52 1 149 3 secB Protein-export protein SecB Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q3JF20 2.6e-48 156 51 1 135 3 secB Protein-export protein SecB Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q604K2 8.97e-48 154 50 0 135 3 secB Protein-export protein SecB Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B6IYY4 1.99e-47 154 56 1 146 3 secB Protein-export protein SecB Coxiella burnetii (strain CbuG_Q212)
Q83BI9 2.53e-47 154 56 1 146 3 secB Protein-export protein SecB Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9N957 2.53e-47 154 56 1 146 3 secB Protein-export protein SecB Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KF84 2.53e-47 154 56 1 146 3 secB Protein-export protein SecB Coxiella burnetii (strain Dugway 5J108-111)
B6J4L4 2.53e-47 154 56 1 146 3 secB Protein-export protein SecB Coxiella burnetii (strain CbuK_Q154)
Q4FRF4 3.26e-47 153 49 3 154 3 secB Protein-export protein SecB Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1Q9Y8 9.49e-46 149 52 2 134 3 secB Protein-export protein SecB Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q0A5H6 1.85e-45 150 49 0 142 3 secB Protein-export protein SecB Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B0V4V4 3.32e-45 148 47 2 153 3 secB Protein-export protein SecB Acinetobacter baumannii (strain AYE)
A3M237 3.32e-45 148 47 2 153 3 secB Protein-export protein SecB Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VKR1 3.32e-45 148 47 2 153 3 secB Protein-export protein SecB Acinetobacter baumannii (strain SDF)
B2HTB2 3.32e-45 148 47 2 153 3 secB Protein-export protein SecB Acinetobacter baumannii (strain ACICU)
B7I5H3 3.32e-45 148 47 2 153 3 secB Protein-export protein SecB Acinetobacter baumannii (strain AB0057)
B7H063 3.32e-45 148 47 2 153 3 secB Protein-export protein SecB Acinetobacter baumannii (strain AB307-0294)
Q6F801 4.46e-45 147 47 2 153 3 secB Protein-export protein SecB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q0VM78 6.04e-45 147 51 2 130 3 secB Protein-export protein SecB Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
C5BJ23 6.65e-45 147 53 1 128 3 secB Protein-export protein SecB Teredinibacter turnerae (strain ATCC 39867 / T7901)
A1WWC6 1.62e-44 147 46 1 147 3 secB Protein-export protein SecB Halorhodospira halophila (strain DSM 244 / SL1)
Q47IG1 6.38e-44 145 48 0 141 3 secB Protein-export protein SecB Dechloromonas aromatica (strain RCB)
Q9PCH8 7.6e-43 142 45 1 146 3 secB Protein-export protein SecB Xylella fastidiosa (strain 9a5c)
Q87CK2 8.29e-43 142 45 1 146 3 secB Protein-export protein SecB Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U2T9 8.29e-43 142 45 1 146 3 secB Protein-export protein SecB Xylella fastidiosa (strain M12)
B2I5B5 8.29e-43 142 45 1 146 3 secB Protein-export protein SecB Xylella fastidiosa (strain M23)
Q8PDY1 1.03e-42 142 44 0 147 3 secB Protein-export protein SecB Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RLW8 1.03e-42 142 44 0 147 3 secB Protein-export protein SecB Xanthomonas campestris pv. campestris (strain B100)
Q4V073 1.03e-42 142 44 0 147 3 secB Protein-export protein SecB Xanthomonas campestris pv. campestris (strain 8004)
Q5GV22 2.79e-42 141 43 0 147 3 secB Protein-export protein SecB Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SKA9 2.79e-42 141 43 0 147 3 secB Protein-export protein SecB Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NYA6 2.79e-42 141 43 0 147 3 secB Protein-export protein SecB Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B8GR95 8.17e-42 140 45 3 157 3 secB Protein-export protein SecB Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q3BZ76 1.01e-41 140 43 0 147 3 secB Protein-export protein SecB Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PQV0 1.01e-41 140 43 0 147 3 secB Protein-export protein SecB Xanthomonas axonopodis pv. citri (strain 306)
Q0BNM8 2.81e-41 138 45 2 142 3 secB2 Protein-export protein SecB 2 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5B6 2.81e-41 138 45 2 142 3 secB2 Protein-export protein SecB 2 Francisella tularensis subsp. holarctica (strain LVS)
A7N9Y5 2.81e-41 138 45 2 142 3 secB2 Protein-export protein SecB 2 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A4IXL1 2.81e-41 138 45 2 142 3 secB1 Protein-export protein SecB 1 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NEV7 2.81e-41 138 45 2 142 3 secB1 Protein-export protein SecB 1 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14GB0 2.81e-41 138 45 2 142 3 secB1 Protein-export protein SecB 1 Francisella tularensis subsp. tularensis (strain FSC 198)
Q63XU4 4.59e-41 137 45 2 157 3 secB Protein-export protein SecB Burkholderia pseudomallei (strain K96243)
A3N5B3 4.59e-41 137 45 2 157 3 secB Protein-export protein SecB Burkholderia pseudomallei (strain 668)
Q3JWH4 4.59e-41 137 45 2 157 3 secB Protein-export protein SecB Burkholderia pseudomallei (strain 1710b)
A3NR12 4.59e-41 137 45 2 157 3 secB Protein-export protein SecB Burkholderia pseudomallei (strain 1106a)
A1UZX6 4.59e-41 137 45 2 157 3 secB Protein-export protein SecB Burkholderia mallei (strain SAVP1)
Q62F46 4.59e-41 137 45 2 157 3 secB Protein-export protein SecB Burkholderia mallei (strain ATCC 23344)
A2S628 4.59e-41 137 45 2 157 3 secB Protein-export protein SecB Burkholderia mallei (strain NCTC 10229)
A3MQ26 4.59e-41 137 45 2 157 3 secB Protein-export protein SecB Burkholderia mallei (strain NCTC 10247)
B2FHD7 7.69e-41 137 42 0 141 3 secB Protein-export protein SecB Stenotrophomonas maltophilia (strain K279a)
B4SSF8 7.95e-41 137 42 0 141 3 secB Protein-export protein SecB Stenotrophomonas maltophilia (strain R551-3)
A5WDL8 1.03e-40 136 51 2 133 3 secB Protein-export protein SecB Psychrobacter sp. (strain PRwf-1)
Q2T1H2 1.17e-40 136 46 2 155 3 secB Protein-export protein SecB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A0Q810 1.19e-40 136 45 2 142 3 secB2 Protein-export protein SecB 2 Francisella tularensis subsp. novicida (strain U112)
B2JC98 4.93e-40 135 43 2 156 3 secB Protein-export protein SecB Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A1KSA7 6.22e-40 134 47 2 141 3 secB Protein-export protein SecB Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A9M1W7 6.22e-40 134 47 2 141 3 secB Protein-export protein SecB Neisseria meningitidis serogroup C (strain 053442)
B4RQ47 6.43e-40 134 47 2 141 3 secB Protein-export protein SecB Neisseria gonorrhoeae (strain NCCP11945)
Q5FAB1 6.43e-40 134 47 2 141 3 secB Protein-export protein SecB Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9JY16 1.06e-39 134 47 2 141 3 secB Protein-export protein SecB Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JVU8 1.75e-39 133 47 2 141 3 secB Protein-export protein SecB Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B2SX18 2.44e-39 133 43 2 155 3 secB Protein-export protein SecB Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B3PGW2 5.45e-39 132 45 0 128 3 secB Protein-export protein SecB Cellvibrio japonicus (strain Ueda107)
Q2Y9Z4 1.46e-38 131 42 1 151 3 secB Protein-export protein SecB Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q146B7 1.51e-38 131 43 2 155 3 secB Protein-export protein SecB Paraburkholderia xenovorans (strain LB400)
B4EA67 1.93e-38 131 45 1 137 3 secB Protein-export protein SecB Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q1BTB4 1.99e-38 131 45 1 137 3 secB Protein-export protein SecB Burkholderia orbicola (strain AU 1054)
B1JZ58 1.99e-38 131 45 1 137 3 secB Protein-export protein SecB Burkholderia orbicola (strain MC0-3)
A0KAS7 1.99e-38 131 45 1 137 3 secB Protein-export protein SecB Burkholderia cenocepacia (strain HI2424)
Q39CN9 2.2e-38 131 45 1 137 3 secB Protein-export protein SecB Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B1YNA3 2.35e-38 131 45 1 137 3 secB Protein-export protein SecB Burkholderia ambifaria (strain MC40-6)
A9AEK0 2.43e-38 130 45 1 137 3 secB Protein-export protein SecB Burkholderia multivorans (strain ATCC 17616 / 249)
A1K9C3 2.53e-38 130 43 2 150 3 secB Protein-export protein SecB Azoarcus sp. (strain BH72)
A4JI42 2.66e-38 130 45 1 137 3 secB Protein-export protein SecB Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BBK8 2.66e-38 130 45 1 137 3 secB Protein-export protein SecB Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q3SG95 6.5e-38 129 46 0 128 3 secB Protein-export protein SecB Thiobacillus denitrificans (strain ATCC 25259)
B5EKH2 7.56e-38 129 48 2 139 3 secB Protein-export protein SecB Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J4Y5 7.56e-38 129 48 2 139 3 secB Protein-export protein SecB Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A6T312 1.93e-37 129 41 0 145 3 secB Protein-export protein SecB Janthinobacterium sp. (strain Marseille)
B1Y6N9 9.22e-37 126 42 1 142 3 secB Protein-export protein SecB Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q0AIA2 1.35e-36 126 42 3 152 3 secB Protein-export protein SecB Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B2UE35 1.37e-36 127 43 0 144 3 secB Protein-export protein SecB Ralstonia pickettii (strain 12J)
A5EW94 3.21e-36 125 41 2 140 3 secB Protein-export protein SecB Dichelobacter nodosus (strain VCS1703A)
A9IFJ5 7.14e-36 125 41 2 157 3 secB Protein-export protein SecB Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A4J0C0 9.4e-36 124 44 1 130 3 secB2 Protein-export protein SecB 2 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NE99 9.4e-36 124 44 1 130 3 secB2 Protein-export protein SecB 2 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14FQ2 9.4e-36 124 44 1 130 3 secB2 Protein-export protein SecB 2 Francisella tularensis subsp. tularensis (strain FSC 198)
Q0BPA9 9.4e-36 124 44 1 130 3 secB1 Protein-export protein SecB 1 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q467 9.4e-36 124 44 1 130 3 secB1 Protein-export protein SecB 1 Francisella tularensis subsp. novicida (strain U112)
Q2A630 9.4e-36 124 44 1 130 3 secB1 Protein-export protein SecB 1 Francisella tularensis subsp. holarctica (strain LVS)
A7N938 9.4e-36 124 44 1 130 3 secB1 Protein-export protein SecB 1 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q8Y2I0 1.41e-35 124 44 1 141 3 secB Protein-export protein SecB Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A1VKS9 1.76e-35 124 42 1 149 3 secB2 Protein-export protein SecB 2 Polaromonas naphthalenivorans (strain CJ2)
A2SDN9 2.04e-35 123 42 1 137 3 secB Protein-export protein SecB Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q82SU4 3.65e-35 122 39 3 159 3 secB Protein-export protein SecB Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q1GZ85 3.79e-35 122 45 1 144 3 secB Protein-export protein SecB Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q12F47 7.67e-34 119 39 1 144 3 secB Protein-export protein SecB Polaromonas sp. (strain JS666 / ATCC BAA-500)
A4G995 1.18e-33 119 37 0 146 3 secB Protein-export protein SecB Herminiimonas arsenicoxydans
A1VKR9 1.47e-33 118 39 2 153 3 secB1 Protein-export protein SecB 1 Polaromonas naphthalenivorans (strain CJ2)
Q21NG8 2.7e-32 115 52 1 128 3 secB Protein-export protein SecB Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A1TTW2 4.52e-32 114 39 2 150 3 secB Protein-export protein SecB Paracidovorax citrulli (strain AAC00-1)
Q5P7N1 8.5e-32 114 42 1 128 3 secB Protein-export protein SecB Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A0LD65 1.81e-31 113 40 1 130 3 secB Protein-export protein SecB Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q21YV7 4.81e-31 112 40 1 137 3 secB Protein-export protein SecB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q476J4 1.38e-30 111 42 1 141 3 secB Protein-export protein SecB Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A5VD08 1.77e-30 111 41 1 136 3 secB Protein-export protein SecB Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q9EZ97 2.27e-30 110 42 1 131 3 secB Protein-export protein SecB Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B2AGQ0 3.24e-30 110 42 1 145 3 secB Protein-export protein SecB Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q1GRJ6 1.03e-29 109 36 0 144 3 secB Protein-export protein SecB Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q0KET5 1.27e-29 109 41 1 145 3 secB Protein-export protein SecB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q7VS46 1.72e-29 108 42 0 139 3 secB Protein-export protein SecB Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W1Q9 1.72e-29 108 42 0 139 3 secB Protein-export protein SecB Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WQN5 1.72e-29 108 42 0 139 3 secB Protein-export protein SecB Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A1WBJ0 1.82e-29 108 39 0 123 3 secB Protein-export protein SecB Acidovorax sp. (strain JS42)
B9MEY9 1.82e-29 108 39 0 123 3 secB Protein-export protein SecB Acidovorax ebreus (strain TPSY)
Q1LRT6 2.79e-29 108 40 0 143 3 secB Protein-export protein SecB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q6AS31 6.64e-29 107 37 2 151 3 secB Protein-export protein SecB Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A1WDX7 7.16e-29 106 35 1 137 3 secB Protein-export protein SecB Verminephrobacter eiseniae (strain EF01-2)
Q13E29 4.82e-28 104 40 1 138 3 secB Protein-export protein SecB Rhodopseudomonas palustris (strain BisB5)
Q2L0A9 1.75e-27 103 39 1 146 3 secB Protein-export protein SecB Bordetella avium (strain 197N)
Q2J350 4.24e-26 99 38 1 138 3 secB Protein-export protein SecB Rhodopseudomonas palustris (strain HaA2)
B3Q8B5 1.76e-25 98 36 1 138 3 secB Protein-export protein SecB Rhodopseudomonas palustris (strain TIE-1)
Q6ND07 1.76e-25 98 36 1 138 3 secB Protein-export protein SecB Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q3SWG7 3.32e-25 97 37 2 143 3 secB Protein-export protein SecB Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q07UP9 5.1e-25 97 39 2 143 3 secB Protein-export protein SecB Rhodopseudomonas palustris (strain BisA53)
Q89WN7 6.53e-25 96 39 2 141 3 secB Protein-export protein SecB Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A5FZF9 9.42e-25 96 36 5 167 3 secB Protein-export protein SecB Acidiphilium cryptum (strain JF-5)
B6JAL0 5.41e-24 94 37 2 137 3 secB Protein-export protein SecB Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A5E8G0 7.42e-24 94 35 1 142 3 secB Protein-export protein SecB Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A4YJU2 8.82e-24 94 35 2 146 3 secB Protein-export protein SecB Bradyrhizobium sp. (strain ORS 278)
Q6G540 7.99e-23 91 31 1 141 3 secB Protein-export protein SecB Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q1QRY0 9.02e-23 91 36 2 143 3 secB Protein-export protein SecB Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q6G0W9 9.09e-23 91 31 1 145 3 secB Protein-export protein SecB Bartonella quintana (strain Toulouse)
Q2N7Z9 1.33e-22 91 34 0 139 3 secB Protein-export protein SecB Erythrobacter litoralis (strain HTCC2594)
Q21CL3 4.05e-22 89 37 1 135 3 secB Protein-export protein SecB Rhodopseudomonas palustris (strain BisB18)
A7IGA7 9.94e-22 88 35 1 144 3 secB Protein-export protein SecB Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q0BPL8 1.05e-21 89 35 5 143 3 secB Protein-export protein SecB Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B6IU92 1.6e-21 88 34 2 137 3 secB Protein-export protein SecB Rhodospirillum centenum (strain ATCC 51521 / SW)
Q0C6A3 1.65e-21 88 32 3 154 3 secB Protein-export protein SecB Hyphomonas neptunium (strain ATCC 15444)
A1UU92 3.1e-21 87 27 1 151 3 secB Protein-export protein SecB Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B2ICZ5 1.43e-20 85 33 1 142 3 secB Protein-export protein SecB Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A7HSI7 2.77e-20 85 32 1 128 3 secB Protein-export protein SecB Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q98DU8 3.22e-20 84 31 2 144 3 secB Protein-export protein SecB Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2GAU0 3.29e-20 85 32 0 133 3 secB Protein-export protein SecB Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q1MNF1 3.92e-20 84 29 2 156 3 secB Protein-export protein SecB Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2KE96 4.01e-20 84 30 1 146 3 secB Protein-export protein SecB Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B5ZV56 4.23e-20 84 31 3 158 3 secB Protein-export protein SecB Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q5FG94 8e-20 84 31 4 156 3 secB Protein-export protein SecB Ehrlichia ruminantium (strain Gardel)
A8I1W4 1.3e-19 83 32 1 146 3 secB Protein-export protein SecB Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q0AKD3 1.35e-19 83 34 1 122 3 secB Protein-export protein SecB Maricaulis maris (strain MCS10)
Q8FY19 1.35e-19 83 30 1 146 3 secB Protein-export protein SecB Brucella suis biovar 1 (strain 1330)
B0CJH2 1.35e-19 83 30 1 146 3 secB Protein-export protein SecB Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VT30 1.35e-19 83 30 1 146 3 secB Protein-export protein SecB Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YE23 1.35e-19 83 30 1 146 3 secB Protein-export protein SecB Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFW0 1.35e-19 83 30 1 146 3 secB Protein-export protein SecB Brucella melitensis biotype 2 (strain ATCC 23457)
P0C125 1.35e-19 83 30 1 146 3 secB Protein-export protein SecB Brucella abortus biovar 1 (strain 9-941)
P0C126 1.35e-19 83 30 1 146 3 secB Protein-export protein SecB Brucella abortus (strain 2308)
B2S971 1.35e-19 83 30 1 146 3 secB Protein-export protein SecB Brucella abortus (strain S19)
B8EQM2 1.42e-19 83 32 2 137 3 secB Protein-export protein SecB Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A9M9Q7 1.51e-19 83 30 1 146 3 secB Protein-export protein SecB Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
B4RBG0 1.99e-19 82 30 1 132 3 secB Protein-export protein SecB Phenylobacterium zucineum (strain HLK1)
Q5PBR8 2.54e-19 82 31 4 152 3 secB Protein-export protein SecB Anaplasma marginale (strain St. Maries)
B9KHK9 2.54e-19 82 31 4 152 3 secB Protein-export protein SecB Anaplasma marginale (strain Florida)
B3PVT7 2.72e-19 82 29 2 155 3 secB Protein-export protein SecB Rhizobium etli (strain CIAT 652)
Q92TE7 3.54e-19 82 30 2 145 3 secB Protein-export protein SecB Rhizobium meliloti (strain 1021)
Q5HAD9 3.57e-19 82 30 4 156 3 secB Protein-export protein SecB Ehrlichia ruminantium (strain Welgevonden)
A6UEF8 4.83e-19 82 29 1 142 3 secB Protein-export protein SecB Sinorhizobium medicae (strain WSM419)
A6WX66 6.89e-19 81 29 1 145 3 secB Protein-export protein SecB Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q2GHM9 8.4e-19 81 30 3 152 3 secB Protein-export protein SecB Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
C0R5F0 8.68e-19 81 33 5 157 3 secB Protein-export protein SecB Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73IQ0 8.68e-19 81 33 5 157 3 secB Protein-export protein SecB Wolbachia pipientis wMel
C3MB76 1.17e-18 80 30 2 147 3 secB Protein-export protein SecB Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q4UNF2 1.45e-18 80 30 3 141 3 secB Protein-export protein SecB Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q8UJC2 1.81e-18 80 30 1 143 3 secB Protein-export protein SecB Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2GE48 3.32e-18 79 33 2 127 3 secB Protein-export protein SecB Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q68XU4 4.43e-18 79 29 3 141 3 secB Protein-export protein SecB Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A8EXD7 4.98e-18 79 29 3 141 3 secB Protein-export protein SecB Rickettsia canadensis (strain McKiel)
Q2GLM6 5.2e-18 79 31 3 136 3 secB Protein-export protein SecB Anaplasma phagocytophilum (strain HZ)
B8GW20 5.24e-18 79 32 1 133 3 secB Protein-export protein SecB Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A224 5.24e-18 79 32 1 133 3 secB Protein-export protein SecB Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q3YR47 6.23e-18 79 30 4 158 3 secB Protein-export protein SecB Ehrlichia canis (strain Jake)
Q2RN91 7.51e-18 78 31 2 124 3 secB Protein-export protein SecB Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A8GM17 7.97e-18 78 29 3 141 3 secB Protein-export protein SecB Rickettsia akari (strain Hartford)
Q5GS95 8.98e-18 78 32 5 156 3 secB Protein-export protein SecB Wolbachia sp. subsp. Brugia malayi (strain TRS)
B0T6F4 1.53e-17 77 30 1 139 3 secB Protein-export protein SecB Caulobacter sp. (strain K31)
Q11CM1 1.76e-17 77 30 1 143 3 secB Protein-export protein SecB Chelativorans sp. (strain BNC1)
A8F0H7 1.98e-17 77 26 2 147 3 secB Protein-export protein SecB Rickettsia massiliae (strain Mtu5)
Q1RGY7 2.53e-17 77 30 3 140 3 secB Protein-export protein SecB Rickettsia bellii (strain RML369-C)
A8GUI7 2.53e-17 77 30 3 140 3 secB Protein-export protein SecB Rickettsia bellii (strain OSU 85-389)
Q9ZE76 2.81e-17 77 29 3 141 3 secB Protein-export protein SecB Rickettsia prowazekii (strain Madrid E)
Q92JG7 2.91e-17 77 29 3 141 3 secB Protein-export protein SecB Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A8GQN4 3e-17 76 29 3 141 3 secB Protein-export protein SecB Rickettsia rickettsii (strain Sheila Smith)
B0BW24 3e-17 76 29 3 141 3 secB Protein-export protein SecB Rickettsia rickettsii (strain Iowa)
C4K189 3e-17 76 29 3 141 3 secB Protein-export protein SecB Rickettsia peacockii (strain Rustic)
Q16CY7 3.29e-17 77 29 2 138 3 secB Protein-export protein SecB Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B3CUK7 3.5e-17 77 32 2 134 3 secB Protein-export protein SecB Orientia tsutsugamushi (strain Ikeda)
C3PMB1 3.52e-17 76 28 2 132 3 secB Protein-export protein SecB Rickettsia africae (strain ESF-5)
Q1GCM7 5.78e-17 76 29 2 150 3 secB Protein-export protein SecB Ruegeria sp. (strain TM1040)
A1B5S4 6.19e-17 76 32 4 140 3 secB Protein-export protein SecB Paracoccus denitrificans (strain Pd 1222)
A5CFN0 1.07e-16 75 32 2 125 3 secB Protein-export protein SecB Orientia tsutsugamushi (strain Boryong)
B3CMS4 5.7e-16 73 32 4 144 3 secB Protein-export protein SecB Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Q2VYH7 1.13e-15 72 33 3 116 3 secB Protein-export protein SecB Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B9KPW0 2.62e-15 72 33 4 141 3 secB Protein-export protein SecB Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3IYG6 2.62e-15 72 33 4 141 3 secB Protein-export protein SecB Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PNT4 2.62e-15 72 33 4 141 3 secB Protein-export protein SecB Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A4WVZ7 4.75e-15 71 32 4 141 3 secB Protein-export protein SecB Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q5LLN4 8.69e-15 70 28 2 141 3 secB Protein-export protein SecB Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5FPS3 5.59e-14 68 28 4 147 3 secB1 Protein-export protein SecB 1 Gluconobacter oxydans (strain 621H)
A8LPB5 5.15e-13 66 28 2 131 3 secB Protein-export protein SecB Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q28W02 5.27e-13 66 27 2 126 3 secB Protein-export protein SecB Jannaschia sp. (strain CCS1)
A9HK92 2.54e-10 58 26 4 140 3 secB Protein-export protein SecB Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q5FNS6 7.78e-06 47 25 4 140 3 secB2 Protein-export protein SecB 2 Gluconobacter oxydans (strain 621H)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_16955
Feature type CDS
Gene secB
Product protein-export chaperone SecB
Location 56169 - 56642 (strand: 1)
Length 474 (nucleotides) / 157 (amino acids)

Contig

Accession ZDB_698
Length 62170 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2172
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02556 Preprotein translocase subunit SecB

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1952 Intracellular trafficking, secretion, and vesicular transport (U) U Preprotein translocase subunit SecB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03071 preprotein translocase subunit SecB Quorum sensing
Protein export
Bacterial secretion system		 -

Protein Sequence

MSEQQNTEMSFNIQRVYTKDISFEAPNAPAVFQQEWQPEVKMDLDTGSTKLADDVYEIVLRVTVTATMGEETAFLCEVQQAGIFTIGGLEGTQLAHCLGAYCPNILFPYARECIAGLVGRGTFPQLNLAPVNFDALFMNYLQQQEQQQAAQEGTQEA

Flanking regions ( +/- flanking 50bp)

CATCCCCTTTGTAACTCACACTCTTTATATGGATATCAAAAGGTAACACTATGTCAGAACAACAAAACACAGAAATGTCTTTCAACATTCAGCGCGTTTACACCAAAGATATTTCTTTTGAAGCGCCGAATGCACCTGCCGTTTTCCAGCAGGAGTGGCAGCCGGAAGTGAAAATGGATCTGGACACCGGCTCAACCAAACTGGCTGATGACGTTTATGAAATCGTTCTGCGCGTCACTGTGACAGCAACCATGGGCGAAGAAACCGCATTCCTGTGTGAAGTTCAGCAGGCCGGTATTTTCACCATCGGCGGTCTGGAAGGTACTCAGCTGGCACACTGCCTGGGTGCATACTGCCCGAATATCCTGTTCCCGTATGCCCGTGAGTGCATCGCAGGTCTGGTCGGCCGCGGTACATTCCCTCAGCTGAACCTGGCACCGGTTAACTTCGATGCACTGTTCATGAACTATCTGCAGCAGCAGGAACAACAGCAGGCTGCGCAGGAAGGTACACAGGAAGCATAATGACAGACGCTTCTATGACTGTACTCGGTGCCGGTTCATACGGCACCGCT