Homologs in group_2208

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16340 FBDBKF_16340 95.5 Morganella morganii S1 secB protein-export chaperone SecB
EHELCC_16375 EHELCC_16375 95.5 Morganella morganii S2 secB protein-export chaperone SecB
NLDBIP_16965 NLDBIP_16965 95.5 Morganella morganii S4 secB protein-export chaperone SecB
LHKJJB_16885 LHKJJB_16885 95.5 Morganella morganii S3 secB protein-export chaperone SecB
HKOGLL_16955 HKOGLL_16955 95.5 Morganella morganii S5 secB protein-export chaperone SecB
PMI_RS15740 PMI_RS15740 80.9 Proteus mirabilis HI4320 secB protein-export chaperone SecB

Distribution of the homologs in the orthogroup group_2208

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2208

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
C6DIA3 2.44e-95 275 83 0 151 3 secB Protein-export protein SecB Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q8KRM2 3.13e-95 275 82 0 153 3 secB Protein-export protein SecB Serratia marcescens
Q7CPH8 6.68e-94 271 81 1 155 3 secB Protein-export protein SecB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGG5 6.68e-94 271 81 1 155 3 secB Protein-export protein SecB Salmonella typhi
B4TZV2 6.68e-94 271 81 1 155 3 secB Protein-export protein SecB Salmonella schwarzengrund (strain CVM19633)
B5BHY4 6.68e-94 271 81 1 155 3 secB Protein-export protein SecB Salmonella paratyphi A (strain AKU_12601)
C0Q1U3 6.68e-94 271 81 1 155 3 secB Protein-export protein SecB Salmonella paratyphi C (strain RKS4594)
A9MVK3 6.68e-94 271 81 1 155 3 secB Protein-export protein SecB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PBZ5 6.68e-94 271 81 1 155 3 secB Protein-export protein SecB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SXB2 6.68e-94 271 81 1 155 3 secB Protein-export protein SecB Salmonella newport (strain SL254)
B4T994 6.68e-94 271 81 1 155 3 secB Protein-export protein SecB Salmonella heidelberg (strain SL476)
B5RGH7 6.68e-94 271 81 1 155 3 secB Protein-export protein SecB Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5D4 6.68e-94 271 81 1 155 3 secB Protein-export protein SecB Salmonella enteritidis PT4 (strain P125109)
B5FLH9 6.68e-94 271 81 1 155 3 secB Protein-export protein SecB Salmonella dublin (strain CT_02021853)
Q57ID2 6.68e-94 271 81 1 155 3 secB Protein-export protein SecB Salmonella choleraesuis (strain SC-B67)
A9MKR5 6.68e-94 271 81 1 155 3 secB Protein-export protein SecB Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5EXB6 6.68e-94 271 81 1 155 3 secB Protein-export protein SecB Salmonella agona (strain SL483)
A8GLB9 1.1e-93 271 80 0 153 3 secB Protein-export protein SecB Serratia proteamaculans (strain 568)
Q329P5 1.32e-93 271 81 1 155 3 secB Protein-export protein SecB Shigella dysenteriae serotype 1 (strain Sd197)
Q1R4Y5 1.32e-93 271 81 1 155 3 secB Protein-export protein SecB Escherichia coli (strain UTI89 / UPEC)
B6I3I8 1.32e-93 271 81 1 155 3 secB Protein-export protein SecB Escherichia coli (strain SE11)
B1IZI1 1.32e-93 271 81 1 155 3 secB Protein-export protein SecB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TBJ7 1.32e-93 271 81 1 155 3 secB Protein-export protein SecB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AHE6 1.32e-93 271 81 1 155 3 secB Protein-export protein SecB Escherichia coli O1:K1 / APEC
B7N255 1.32e-93 271 81 1 155 3 secB Protein-export protein SecB Escherichia coli O81 (strain ED1a)
B7MFH3 1.32e-93 271 81 1 155 3 secB Protein-export protein SecB Escherichia coli O45:K1 (strain S88 / ExPEC)
B7ULG5 1.32e-93 271 81 1 155 3 secB Protein-export protein SecB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A8ARJ6 1.32e-93 271 81 1 155 3 secB Protein-export protein SecB Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q6DAT1 1.68e-93 270 84 0 146 3 secB Protein-export protein SecB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JHY4 1.72e-93 270 82 0 150 3 secB Protein-export protein SecB Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JQV6 1.88e-93 270 84 0 146 3 secB Protein-export protein SecB Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66GB9 1.88e-93 270 84 0 146 3 secB Protein-export protein SecB Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TSB9 1.88e-93 270 84 0 146 3 secB Protein-export protein SecB Yersinia pestis (strain Pestoides F)
Q1CD20 1.88e-93 270 84 0 146 3 secB Protein-export protein SecB Yersinia pestis bv. Antiqua (strain Nepal516)
A9R690 1.88e-93 270 84 0 146 3 secB Protein-export protein SecB Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJM7 1.88e-93 270 84 0 146 3 secB Protein-export protein SecB Yersinia pestis
B2JYQ0 1.88e-93 270 84 0 146 3 secB Protein-export protein SecB Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C285 1.88e-93 270 84 0 146 3 secB Protein-export protein SecB Yersinia pestis bv. Antiqua (strain Antiqua)
A7FCV1 1.88e-93 270 84 0 146 3 secB Protein-export protein SecB Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B7LTL6 2.11e-93 270 81 1 155 3 secB Protein-export protein SecB Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4W536 2.33e-93 270 81 1 155 3 secB Protein-export protein SecB Enterobacter sp. (strain 638)
P0AG89 3.42e-93 270 80 1 155 3 secB Protein-export protein SecB Shigella flexneri
Q0SYD5 3.42e-93 270 80 1 155 3 secB Protein-export protein SecB Shigella flexneri serotype 5b (strain 8401)
Q31V12 3.42e-93 270 80 1 155 3 secB Protein-export protein SecB Shigella boydii serotype 4 (strain Sb227)
B2U5C8 3.42e-93 270 80 1 155 3 secB Protein-export protein SecB Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LK48 3.42e-93 270 80 1 155 3 secB Protein-export protein SecB Escherichia coli (strain SMS-3-5 / SECEC)
B7NER6 3.42e-93 270 80 1 155 3 secB Protein-export protein SecB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AG86 3.42e-93 270 80 1 155 1 secB Protein-export protein SecB Escherichia coli (strain K12)
P0AG87 3.42e-93 270 80 1 155 3 secB Protein-export protein SecB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A674 3.42e-93 270 80 1 155 3 secB Protein-export protein SecB Escherichia coli O9:H4 (strain HS)
B1X943 3.42e-93 270 80 1 155 3 secB Protein-export protein SecB Escherichia coli (strain K12 / DH10B)
C4ZXK1 3.42e-93 270 80 1 155 3 secB Protein-export protein SecB Escherichia coli (strain K12 / MC4100 / BW2952)
B7M496 3.42e-93 270 80 1 155 3 secB Protein-export protein SecB Escherichia coli O8 (strain IAI1)
B7NPB8 3.42e-93 270 80 1 155 3 secB Protein-export protein SecB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YWB1 3.42e-93 270 80 1 155 3 secB Protein-export protein SecB Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AG88 3.42e-93 270 80 1 155 3 secB Protein-export protein SecB Escherichia coli O157:H7
B7L735 3.42e-93 270 80 1 155 3 secB Protein-export protein SecB Escherichia coli (strain 55989 / EAEC)
A7ZTG3 3.42e-93 270 80 1 155 3 secB Protein-export protein SecB Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7MY53 4.52e-93 269 81 1 157 3 secB Protein-export protein SecB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C5BC34 5.07e-93 269 85 0 144 3 secB Protein-export protein SecB Edwardsiella ictaluri (strain 93-146)
Q3YVX4 8.23e-93 268 80 1 155 3 secB Protein-export protein SecB Shigella sonnei (strain Ss046)
B2VL52 2.6e-92 267 82 0 145 3 secB Protein-export protein SecB Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7MID6 1.35e-91 265 80 0 153 3 secB Protein-export protein SecB Cronobacter sakazakii (strain ATCC BAA-894)
A6TFK4 1.61e-90 263 78 1 158 3 secB Protein-export protein SecB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XTJ1 1.61e-90 263 78 1 158 3 secB Protein-export protein SecB Klebsiella pneumoniae (strain 342)
B4F139 2.73e-89 259 79 1 159 3 secB Protein-export protein SecB Proteus mirabilis (strain HI4320)
Q2NQW5 5.15e-89 259 76 0 152 3 secB Protein-export protein SecB Sodalis glossinidius (strain morsitans)
A1S1L8 2.97e-78 232 70 2 160 3 secB Protein-export protein SecB Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8HAD8 4.61e-77 229 74 1 148 3 secB Protein-export protein SecB Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A1RQ93 1.98e-76 227 72 1 148 3 secB Protein-export protein SecB Shewanella sp. (strain W3-18-1)
B8CGT2 1.98e-76 227 73 1 148 3 secB Protein-export protein SecB Shewanella piezotolerans (strain WP3 / JCM 13877)
A4Y1E5 1.98e-76 227 72 1 148 3 secB Protein-export protein SecB Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A8G1U7 7.29e-76 226 74 1 144 3 secB Protein-export protein SecB Shewanella sediminis (strain HAW-EB3)
A9KUC0 1.79e-75 225 72 1 148 3 secB Protein-export protein SecB Shewanella baltica (strain OS195)
A6WHC9 1.79e-75 225 72 1 148 3 secB Protein-export protein SecB Shewanella baltica (strain OS185)
B8E3F6 1.79e-75 225 72 1 148 3 secB Protein-export protein SecB Shewanella baltica (strain OS223)
A3QJM2 1.89e-75 225 75 1 144 3 secB Protein-export protein SecB Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q07VX0 1.97e-75 225 70 1 148 3 secB Protein-export protein SecB Shewanella frigidimarina (strain NCIMB 400)
Q3IIE1 3.81e-75 224 70 0 144 3 secB Protein-export protein SecB Pseudoalteromonas translucida (strain TAC 125)
A3DAM8 7.77e-75 223 72 1 148 3 secB Protein-export protein SecB Shewanella baltica (strain OS155 / ATCC BAA-1091)
B1KQ11 7.78e-75 223 71 1 148 3 secB Protein-export protein SecB Shewanella woodyi (strain ATCC 51908 / MS32)
Q12HV7 9.17e-75 223 76 0 136 3 secB Protein-export protein SecB Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B0TLE8 3.19e-74 222 76 1 140 3 secB Protein-export protein SecB Shewanella halifaxensis (strain HAW-EB4)
Q8EKP0 1.37e-73 220 75 1 140 3 secB Protein-export protein SecB Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0I0Q4 5.28e-73 219 74 1 140 3 secB Protein-export protein SecB Shewanella sp. (strain MR-7)
Q0HP89 7.33e-73 218 74 1 140 3 secB Protein-export protein SecB Shewanella sp. (strain MR-4)
A0KR79 7.33e-73 218 74 1 140 3 secB Protein-export protein SecB Shewanella sp. (strain ANA-3)
C4LA08 6.99e-72 216 64 1 154 3 secB Protein-export protein SecB Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B4S0I7 1.07e-71 216 66 1 144 3 secB Protein-export protein SecB Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q6LVL0 2.05e-71 214 66 1 148 3 secB Protein-export protein SecB Photobacterium profundum (strain SS9)
A1SZI0 2.71e-70 212 62 1 151 3 secB Protein-export protein SecB Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B5FBT9 3.42e-70 211 68 0 138 3 secB Protein-export protein SecB Aliivibrio fischeri (strain MJ11)
Q5E2A2 3.42e-70 211 68 0 138 3 secB Protein-export protein SecB Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q47VY5 3.65e-70 212 66 0 141 3 secB Protein-export protein SecB Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
C4K4M5 1.33e-69 210 60 0 148 3 secB Protein-export protein SecB Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B6EN68 7.25e-69 208 67 1 142 3 secB Protein-export protein SecB Aliivibrio salmonicida (strain LFI1238)
Q7MGY8 1.43e-68 207 67 0 137 3 secB Protein-export protein SecB Vibrio vulnificus (strain YJ016)
Q8DCW3 1.43e-68 207 67 0 137 3 secB Protein-export protein SecB Vibrio vulnificus (strain CMCP6)
A0KF07 2.92e-68 206 69 0 133 3 secB Protein-export protein SecB Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B7VHM6 4.14e-68 206 65 0 138 3 secB Protein-export protein SecB Vibrio atlanticus (strain LGP32)
A7MX74 5.38e-68 206 67 0 137 3 secB Protein-export protein SecB Vibrio campbellii (strain ATCC BAA-1116)
A4ST21 1.08e-67 205 68 0 134 3 secB Protein-export protein SecB Aeromonas salmonicida (strain A449)
C3LRW4 1.2e-67 205 67 0 137 3 secB Protein-export protein SecB Vibrio cholerae serotype O1 (strain M66-2)
Q9KNS8 1.2e-67 205 67 0 137 3 secB Protein-export protein SecB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4Y6 1.2e-67 205 67 0 137 3 secB Protein-export protein SecB Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87KZ3 1.35e-67 205 67 0 137 3 secB Protein-export protein SecB Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q15PS2 1.59e-67 205 68 0 134 3 secB Protein-export protein SecB Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B0BRA2 1.36e-66 202 60 2 153 3 secB Protein-export protein SecB Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GYJ0 1.36e-66 202 60 2 153 3 secB Protein-export protein SecB Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N2F7 1.65e-66 202 60 2 153 3 secB Protein-export protein SecB Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0UUY0 2.9e-65 199 59 1 149 3 secB Protein-export protein SecB Histophilus somni (strain 2336)
Q0I0W6 2.9e-65 199 59 1 149 3 secB Protein-export protein SecB Histophilus somni (strain 129Pt)
Q7VN99 1.53e-64 197 60 1 142 3 secB Protein-export protein SecB Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q65QD9 6.72e-64 196 59 1 146 3 secB Protein-export protein SecB Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B8F6T7 4.32e-63 194 57 1 149 3 secB Protein-export protein SecB Glaesserella parasuis serovar 5 (strain SH0165)
P44853 6.06e-61 188 59 1 135 1 secB Protein-export protein SecB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QMF4 6.06e-61 188 59 1 135 3 secB Protein-export protein SecB Haemophilus influenzae (strain 86-028NP)
A5UHP8 6.4e-61 188 59 1 135 3 secB Protein-export protein SecB Haemophilus influenzae (strain PittGG)
Q9CL16 1.23e-60 187 60 1 133 3 secB Protein-export protein SecB Pasteurella multocida (strain Pm70)
Q5ZT57 2.07e-60 187 59 1 149 3 secB Protein-export protein SecB Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5UDY2 2.4e-60 187 58 1 135 3 secB Protein-export protein SecB Haemophilus influenzae (strain PittEE)
Q491X9 1.43e-59 184 54 0 142 3 secB Protein-export protein SecB Blochmanniella pennsylvanica (strain BPEN)
Q5QZA7 6e-59 183 56 1 141 3 secB Protein-export protein SecB Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B8D6W5 5.06e-58 180 50 0 142 3 secB Protein-export protein SecB Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57161 5.06e-58 180 50 0 142 3 secB Protein-export protein SecB Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8L1 5.06e-58 180 50 0 142 3 secB Protein-export protein SecB Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A1U5G9 6.59e-58 181 53 1 144 3 secB Protein-export protein SecB Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A6VLB7 1.25e-57 180 53 1 152 3 secB Protein-export protein SecB Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
C3K7C1 1.94e-57 179 51 1 159 3 secB Protein-export protein SecB Pseudomonas fluorescens (strain SBW25)
Q93TF4 3.2e-57 179 51 1 160 3 secB Protein-export protein SecB Pseudomonas fluorescens
Q3KJH6 3.52e-57 179 53 1 153 3 secB Protein-export protein SecB Pseudomonas fluorescens (strain Pf0-1)
A4VRU9 4.25e-56 176 54 1 144 3 secB Protein-export protein SecB Stutzerimonas stutzeri (strain A1501)
Q87UH3 9.44e-56 175 57 0 136 3 secB Protein-export protein SecB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZLR3 2.53e-55 174 56 0 136 3 secB Protein-export protein SecB Pseudomonas syringae pv. syringae (strain B728a)
Q5WUE1 2.56e-55 174 59 1 149 3 secB Protein-export protein SecB Legionella pneumophila (strain Lens)
A5IEA6 2.56e-55 174 59 1 149 3 secB Protein-export protein SecB Legionella pneumophila (strain Corby)
Q5X2Y1 2.56e-55 174 59 1 149 3 secB Protein-export protein SecB Legionella pneumophila (strain Paris)
Q48C90 2.79e-55 174 56 0 136 3 secB Protein-export protein SecB Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A4Y074 2.92e-55 174 52 1 150 3 secB Protein-export protein SecB Pseudomonas mendocina (strain ymp)
Q4KJR5 3.37e-55 174 53 1 149 3 secB Protein-export protein SecB Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P32002 1.06e-54 172 50 0 145 3 secB Protein-export protein SecB Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q2SMA3 1.78e-54 172 58 0 127 3 secB Protein-export protein SecB Hahella chejuensis (strain KCTC 2396)
Q1IG59 2.5e-53 169 49 1 152 3 secB Protein-export protein SecB Pseudomonas entomophila (strain L48)
B1J2T8 2.67e-53 169 52 0 136 3 secB Protein-export protein SecB Pseudomonas putida (strain W619)
Q88CX7 2.85e-53 169 52 0 136 3 secB Protein-export protein SecB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WA86 2.85e-53 169 52 0 136 3 secB Protein-export protein SecB Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0KN08 5.98e-53 168 52 0 136 3 secB Protein-export protein SecB Pseudomonas putida (strain GB-1)
Q1R1J5 1.66e-52 167 51 2 147 3 secB Protein-export protein SecB Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
C1DJD9 1.68e-52 167 53 2 149 3 secB Protein-export protein SecB Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q31E80 6.52e-52 165 52 1 146 3 secB Protein-export protein SecB Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q9HU56 5.2e-51 163 54 1 128 3 secB Protein-export protein SecB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02EN8 5.2e-51 163 54 1 128 3 secB Protein-export protein SecB Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3M1 5.2e-51 163 54 1 128 3 secB Protein-export protein SecB Pseudomonas aeruginosa (strain LESB58)
A6VDP6 5.2e-51 163 54 1 128 3 secB Protein-export protein SecB Pseudomonas aeruginosa (strain PA7)
A6VT70 8.94e-51 162 51 0 135 3 secB Protein-export protein SecB Marinomonas sp. (strain MWYL1)
Q7NYZ5 1.44e-49 159 52 1 151 3 secB Protein-export protein SecB Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q3JF20 1.06e-47 155 51 1 135 3 secB Protein-export protein SecB Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q604K2 1.34e-47 154 50 0 135 3 secB Protein-export protein SecB Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q0A5H6 8.16e-46 150 50 1 150 3 secB Protein-export protein SecB Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q4FRF4 1.45e-45 149 50 2 143 3 secB Protein-export protein SecB Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B0V4V4 5.01e-45 147 46 2 154 3 secB Protein-export protein SecB Acinetobacter baumannii (strain AYE)
A3M237 5.01e-45 147 46 2 154 3 secB Protein-export protein SecB Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VKR1 5.01e-45 147 46 2 154 3 secB Protein-export protein SecB Acinetobacter baumannii (strain SDF)
B2HTB2 5.01e-45 147 46 2 154 3 secB Protein-export protein SecB Acinetobacter baumannii (strain ACICU)
B7I5H3 5.01e-45 147 46 2 154 3 secB Protein-export protein SecB Acinetobacter baumannii (strain AB0057)
B7H063 5.01e-45 147 46 2 154 3 secB Protein-export protein SecB Acinetobacter baumannii (strain AB307-0294)
B6IYY4 5.65e-45 148 56 0 135 3 secB Protein-export protein SecB Coxiella burnetii (strain CbuG_Q212)
Q1Q9Y8 5.86e-45 147 52 2 134 3 secB Protein-export protein SecB Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q83BI9 6.58e-45 147 56 0 135 3 secB Protein-export protein SecB Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9N957 6.58e-45 147 56 0 135 3 secB Protein-export protein SecB Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KF84 6.58e-45 147 56 0 135 3 secB Protein-export protein SecB Coxiella burnetii (strain Dugway 5J108-111)
B6J4L4 6.58e-45 147 56 0 135 3 secB Protein-export protein SecB Coxiella burnetii (strain CbuK_Q154)
Q0VM78 3.98e-44 145 50 2 130 3 secB Protein-export protein SecB Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q6F801 5.3e-44 145 46 1 143 3 secB Protein-export protein SecB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
C5BJ23 1.24e-43 144 51 1 128 3 secB Protein-export protein SecB Teredinibacter turnerae (strain ATCC 39867 / T7901)
A1WWC6 1.27e-43 145 46 1 145 3 secB Protein-export protein SecB Halorhodospira halophila (strain DSM 244 / SL1)
Q47IG1 3.68e-43 143 46 0 149 3 secB Protein-export protein SecB Dechloromonas aromatica (strain RCB)
Q87CK2 8.88e-42 140 42 0 150 3 secB Protein-export protein SecB Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U2T9 8.88e-42 140 42 0 150 3 secB Protein-export protein SecB Xylella fastidiosa (strain M12)
B2I5B5 8.88e-42 140 42 0 150 3 secB Protein-export protein SecB Xylella fastidiosa (strain M23)
Q2T1H2 9.68e-42 139 45 1 154 3 secB Protein-export protein SecB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q8PDY1 1.64e-41 139 46 0 136 3 secB Protein-export protein SecB Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RLW8 1.64e-41 139 46 0 136 3 secB Protein-export protein SecB Xanthomonas campestris pv. campestris (strain B100)
Q4V073 1.64e-41 139 46 0 136 3 secB Protein-export protein SecB Xanthomonas campestris pv. campestris (strain 8004)
Q5GV22 2.08e-41 139 44 0 140 3 secB Protein-export protein SecB Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SKA9 2.08e-41 139 44 0 140 3 secB Protein-export protein SecB Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NYA6 2.08e-41 139 44 0 140 3 secB Protein-export protein SecB Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q9PCH8 2.85e-41 139 43 0 144 3 secB Protein-export protein SecB Xylella fastidiosa (strain 9a5c)
Q3BZ76 3.3e-41 138 45 0 137 3 secB Protein-export protein SecB Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PQV0 3.3e-41 138 45 0 137 3 secB Protein-export protein SecB Xanthomonas axonopodis pv. citri (strain 306)
Q63XU4 4.88e-41 137 44 2 156 3 secB Protein-export protein SecB Burkholderia pseudomallei (strain K96243)
A3N5B3 4.88e-41 137 44 2 156 3 secB Protein-export protein SecB Burkholderia pseudomallei (strain 668)
Q3JWH4 4.88e-41 137 44 2 156 3 secB Protein-export protein SecB Burkholderia pseudomallei (strain 1710b)
A3NR12 4.88e-41 137 44 2 156 3 secB Protein-export protein SecB Burkholderia pseudomallei (strain 1106a)
A1UZX6 4.88e-41 137 44 2 156 3 secB Protein-export protein SecB Burkholderia mallei (strain SAVP1)
Q62F46 4.88e-41 137 44 2 156 3 secB Protein-export protein SecB Burkholderia mallei (strain ATCC 23344)
A2S628 4.88e-41 137 44 2 156 3 secB Protein-export protein SecB Burkholderia mallei (strain NCTC 10229)
A3MQ26 4.88e-41 137 44 2 156 3 secB Protein-export protein SecB Burkholderia mallei (strain NCTC 10247)
Q0BNM8 6.49e-41 137 45 2 142 3 secB2 Protein-export protein SecB 2 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5B6 6.49e-41 137 45 2 142 3 secB2 Protein-export protein SecB 2 Francisella tularensis subsp. holarctica (strain LVS)
A7N9Y5 6.49e-41 137 45 2 142 3 secB2 Protein-export protein SecB 2 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A4IXL1 6.49e-41 137 45 2 142 3 secB1 Protein-export protein SecB 1 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NEV7 6.49e-41 137 45 2 142 3 secB1 Protein-export protein SecB 1 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14GB0 6.49e-41 137 45 2 142 3 secB1 Protein-export protein SecB 1 Francisella tularensis subsp. tularensis (strain FSC 198)
B4SSF8 1.02e-40 137 42 0 141 3 secB Protein-export protein SecB Stenotrophomonas maltophilia (strain R551-3)
B2FHD7 1.12e-40 137 42 0 141 3 secB Protein-export protein SecB Stenotrophomonas maltophilia (strain K279a)
B8GR95 1.37e-40 137 43 3 160 3 secB Protein-export protein SecB Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A0Q810 2.76e-40 135 45 2 142 3 secB2 Protein-export protein SecB 2 Francisella tularensis subsp. novicida (strain U112)
A1KSA7 4.32e-40 135 48 2 141 3 secB Protein-export protein SecB Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A9M1W7 4.32e-40 135 48 2 141 3 secB Protein-export protein SecB Neisseria meningitidis serogroup C (strain 053442)
B4RQ47 5.04e-40 135 48 2 141 3 secB Protein-export protein SecB Neisseria gonorrhoeae (strain NCCP11945)
Q5FAB1 5.04e-40 135 48 2 141 3 secB Protein-export protein SecB Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9JY16 8.05e-40 134 48 2 141 3 secB Protein-export protein SecB Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q2Y9Z4 9.56e-40 134 41 2 156 3 secB Protein-export protein SecB Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q9JVU8 1.33e-39 134 48 2 141 3 secB Protein-export protein SecB Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A5WDL8 1.56e-39 134 50 1 130 3 secB Protein-export protein SecB Psychrobacter sp. (strain PRwf-1)
B2JC98 2.21e-39 133 43 1 151 3 secB Protein-export protein SecB Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B2SX18 2.33e-39 133 42 1 154 3 secB Protein-export protein SecB Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q146B7 1.42e-38 131 42 1 154 3 secB Protein-export protein SecB Paraburkholderia xenovorans (strain LB400)
B3PGW2 1.51e-38 132 44 0 128 3 secB Protein-export protein SecB Cellvibrio japonicus (strain Ueda107)
Q3SG95 9.78e-38 129 46 0 128 3 secB Protein-export protein SecB Thiobacillus denitrificans (strain ATCC 25259)
B4EA67 1.2e-37 129 45 1 137 3 secB Protein-export protein SecB Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q1BTB4 1.23e-37 129 45 1 137 3 secB Protein-export protein SecB Burkholderia orbicola (strain AU 1054)
B1JZ58 1.23e-37 129 45 1 137 3 secB Protein-export protein SecB Burkholderia orbicola (strain MC0-3)
A0KAS7 1.23e-37 129 45 1 137 3 secB Protein-export protein SecB Burkholderia cenocepacia (strain HI2424)
A9AEK0 1.25e-37 129 45 1 137 3 secB Protein-export protein SecB Burkholderia multivorans (strain ATCC 17616 / 249)
B1YNA3 1.26e-37 129 45 1 137 3 secB Protein-export protein SecB Burkholderia ambifaria (strain MC40-6)
Q39CN9 1.5e-37 129 45 1 137 3 secB Protein-export protein SecB Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A4JI42 1.61e-37 129 45 1 137 3 secB Protein-export protein SecB Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BBK8 1.61e-37 129 45 1 137 3 secB Protein-export protein SecB Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B5EKH2 1.78e-37 128 48 2 139 3 secB Protein-export protein SecB Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J4Y5 1.78e-37 128 48 2 139 3 secB Protein-export protein SecB Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A1K9C3 4.81e-37 127 41 2 153 3 secB Protein-export protein SecB Azoarcus sp. (strain BH72)
Q8Y2I0 7.24e-37 127 44 1 146 3 secB Protein-export protein SecB Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A6T312 8.63e-37 127 40 0 150 3 secB Protein-export protein SecB Janthinobacterium sp. (strain Marseille)
A5EW94 1.54e-36 126 42 3 159 3 secB Protein-export protein SecB Dichelobacter nodosus (strain VCS1703A)
Q0AIA2 3.09e-36 125 41 3 155 3 secB Protein-export protein SecB Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B1Y6N9 3.24e-36 125 44 0 127 3 secB Protein-export protein SecB Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B2UE35 4.41e-36 125 43 0 141 3 secB Protein-export protein SecB Ralstonia pickettii (strain 12J)
A9IFJ5 1.35e-35 124 39 2 163 3 secB Protein-export protein SecB Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A4J0C0 1.72e-35 123 42 1 135 3 secB2 Protein-export protein SecB 2 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NE99 1.72e-35 123 42 1 135 3 secB2 Protein-export protein SecB 2 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14FQ2 1.72e-35 123 42 1 135 3 secB2 Protein-export protein SecB 2 Francisella tularensis subsp. tularensis (strain FSC 198)
Q0BPA9 1.72e-35 123 42 1 135 3 secB1 Protein-export protein SecB 1 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q467 1.72e-35 123 42 1 135 3 secB1 Protein-export protein SecB 1 Francisella tularensis subsp. novicida (strain U112)
Q2A630 1.72e-35 123 42 1 135 3 secB1 Protein-export protein SecB 1 Francisella tularensis subsp. holarctica (strain LVS)
A7N938 1.72e-35 123 42 1 135 3 secB1 Protein-export protein SecB 1 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A2SDN9 8.23e-35 122 41 1 137 3 secB Protein-export protein SecB Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q1GZ85 1.35e-34 121 45 1 141 3 secB Protein-export protein SecB Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q12F47 2.93e-34 120 37 1 148 3 secB Protein-export protein SecB Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1VKS9 4.6e-34 120 40 2 156 3 secB2 Protein-export protein SecB 2 Polaromonas naphthalenivorans (strain CJ2)
Q82SU4 5.2e-34 120 39 3 161 3 secB Protein-export protein SecB Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1TTW2 3.65e-33 117 39 1 145 3 secB Protein-export protein SecB Paracidovorax citrulli (strain AAC00-1)
A1VKR9 5.28e-33 117 39 2 151 3 secB1 Protein-export protein SecB 1 Polaromonas naphthalenivorans (strain CJ2)
A4G995 6.04e-33 117 36 0 150 3 secB Protein-export protein SecB Herminiimonas arsenicoxydans
Q5P7N1 1.32e-31 114 42 1 128 3 secB Protein-export protein SecB Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q21NG8 6e-31 112 50 1 128 3 secB Protein-export protein SecB Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q21YV7 1.43e-30 111 39 1 137 3 secB Protein-export protein SecB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A0LD65 2.23e-30 110 39 1 128 3 secB Protein-export protein SecB Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q476J4 2.38e-30 111 41 1 145 3 secB Protein-export protein SecB Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q9EZ97 5.59e-30 110 39 0 138 3 secB Protein-export protein SecB Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B2AGQ0 7.65e-30 109 40 0 144 3 secB Protein-export protein SecB Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A5VD08 1.23e-29 108 41 1 134 3 secB Protein-export protein SecB Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q7VS46 1.73e-29 108 40 0 147 3 secB Protein-export protein SecB Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W1Q9 1.73e-29 108 40 0 147 3 secB Protein-export protein SecB Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WQN5 1.73e-29 108 40 0 147 3 secB Protein-export protein SecB Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q1LRT6 1.86e-29 108 41 1 146 3 secB Protein-export protein SecB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q6AS31 2.89e-29 107 37 2 151 3 secB Protein-export protein SecB Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q0KET5 3.33e-29 108 40 0 144 3 secB Protein-export protein SecB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1GRJ6 5.53e-29 107 36 1 152 3 secB Protein-export protein SecB Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A1WBJ0 6.16e-29 107 39 0 123 3 secB Protein-export protein SecB Acidovorax sp. (strain JS42)
B9MEY9 6.16e-29 107 39 0 123 3 secB Protein-export protein SecB Acidovorax ebreus (strain TPSY)
A1WDX7 2.49e-28 105 34 1 137 3 secB Protein-export protein SecB Verminephrobacter eiseniae (strain EF01-2)
Q13E29 4.25e-27 102 39 1 138 3 secB Protein-export protein SecB Rhodopseudomonas palustris (strain BisB5)
Q2L0A9 1.32e-26 101 39 1 143 3 secB Protein-export protein SecB Bordetella avium (strain 197N)
Q89WN7 1.49e-25 98 38 2 147 3 secB Protein-export protein SecB Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q2J350 4.62e-25 97 37 1 138 3 secB Protein-export protein SecB Rhodopseudomonas palustris (strain HaA2)
Q07UP9 9.33e-25 96 39 2 143 3 secB Protein-export protein SecB Rhodopseudomonas palustris (strain BisA53)
A5FZF9 1.55e-24 95 36 5 166 3 secB Protein-export protein SecB Acidiphilium cryptum (strain JF-5)
B3Q8B5 1.77e-24 95 36 1 138 3 secB Protein-export protein SecB Rhodopseudomonas palustris (strain TIE-1)
Q6ND07 1.77e-24 95 36 1 138 3 secB Protein-export protein SecB Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B6JAL0 4.65e-24 94 37 1 133 3 secB Protein-export protein SecB Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q3SWG7 5.36e-24 94 37 2 144 3 secB Protein-export protein SecB Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A4YJU2 3.89e-23 92 36 2 142 3 secB Protein-export protein SecB Bradyrhizobium sp. (strain ORS 278)
A5E8G0 4.78e-23 92 36 2 142 3 secB Protein-export protein SecB Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q1QRY0 3.85e-22 89 36 2 141 3 secB Protein-export protein SecB Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q6G0W9 4.71e-22 89 30 1 146 3 secB Protein-export protein SecB Bartonella quintana (strain Toulouse)
Q6G540 6.16e-22 89 30 1 141 3 secB Protein-export protein SecB Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q21CL3 8.95e-22 89 37 1 135 3 secB Protein-export protein SecB Rhodopseudomonas palustris (strain BisB18)
Q2N7Z9 9.18e-22 89 34 1 143 3 secB Protein-export protein SecB Erythrobacter litoralis (strain HTCC2594)
Q98DU8 2.48e-21 87 32 2 143 3 secB Protein-export protein SecB Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B6IU92 3.61e-21 87 35 2 137 3 secB Protein-export protein SecB Rhodospirillum centenum (strain ATCC 51521 / SW)
Q0C6A3 3.67e-21 87 32 2 147 3 secB Protein-export protein SecB Hyphomonas neptunium (strain ATCC 15444)
Q0BPL8 4.09e-21 87 35 5 143 3 secB Protein-export protein SecB Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
A7IGA7 4.47e-21 87 34 1 144 3 secB Protein-export protein SecB Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
B2ICZ5 4.77e-21 87 33 2 152 3 secB Protein-export protein SecB Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A7HSI7 5.43e-21 87 33 1 128 3 secB Protein-export protein SecB Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B5ZV56 6.66e-21 86 32 3 156 3 secB Protein-export protein SecB Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q2KE96 9.38e-21 86 33 2 146 3 secB Protein-export protein SecB Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q1MNF1 1.08e-20 85 32 3 156 3 secB Protein-export protein SecB Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2GAU0 5.19e-20 84 33 0 138 3 secB Protein-export protein SecB Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B8EQM2 6.69e-20 84 32 1 128 3 secB Protein-export protein SecB Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q5PBR8 7.1e-20 84 32 3 152 3 secB Protein-export protein SecB Anaplasma marginale (strain St. Maries)
B9KHK9 7.1e-20 84 32 3 152 3 secB Protein-export protein SecB Anaplasma marginale (strain Florida)
B3PVT7 7.99e-20 83 32 3 155 3 secB Protein-export protein SecB Rhizobium etli (strain CIAT 652)
B4RBG0 1.23e-19 83 31 1 132 3 secB Protein-export protein SecB Phenylobacterium zucineum (strain HLK1)
A1UU92 1.44e-19 83 27 1 146 3 secB Protein-export protein SecB Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q92TE7 2e-19 82 30 1 137 3 secB Protein-export protein SecB Rhizobium meliloti (strain 1021)
A6UEF8 2.35e-19 82 30 1 142 3 secB Protein-export protein SecB Sinorhizobium medicae (strain WSM419)
Q0AKD3 2.39e-19 82 34 1 122 3 secB Protein-export protein SecB Maricaulis maris (strain MCS10)
C3MB76 7.19e-19 81 30 1 137 3 secB Protein-export protein SecB Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q2GHM9 7.68e-19 81 30 3 152 3 secB Protein-export protein SecB Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
A8I1W4 9.1e-19 80 33 1 137 3 secB Protein-export protein SecB Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q5FG94 1.32e-18 80 30 4 156 3 secB Protein-export protein SecB Ehrlichia ruminantium (strain Gardel)
Q68XU4 1.48e-18 80 30 3 140 3 secB Protein-export protein SecB Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q8FY19 1.61e-18 80 29 1 144 3 secB Protein-export protein SecB Brucella suis biovar 1 (strain 1330)
B0CJH2 1.61e-18 80 29 1 144 3 secB Protein-export protein SecB Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VT30 1.61e-18 80 29 1 144 3 secB Protein-export protein SecB Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YE23 1.61e-18 80 29 1 144 3 secB Protein-export protein SecB Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFW0 1.61e-18 80 29 1 144 3 secB Protein-export protein SecB Brucella melitensis biotype 2 (strain ATCC 23457)
P0C125 1.61e-18 80 29 1 144 3 secB Protein-export protein SecB Brucella abortus biovar 1 (strain 9-941)
P0C126 1.61e-18 80 29 1 144 3 secB Protein-export protein SecB Brucella abortus (strain 2308)
B2S971 1.61e-18 80 29 1 144 3 secB Protein-export protein SecB Brucella abortus (strain S19)
A8EXD7 1.72e-18 80 30 3 140 3 secB Protein-export protein SecB Rickettsia canadensis (strain McKiel)
A9M9Q7 1.79e-18 80 29 1 144 3 secB Protein-export protein SecB Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
C0R5F0 2.31e-18 80 32 4 152 3 secB Protein-export protein SecB Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73IQ0 2.31e-18 80 32 4 152 3 secB Protein-export protein SecB Wolbachia pipientis wMel
Q3YR47 2.91e-18 80 29 4 167 3 secB Protein-export protein SecB Ehrlichia canis (strain Jake)
A8GM17 2.96e-18 79 30 3 140 3 secB Protein-export protein SecB Rickettsia akari (strain Hartford)
Q8UJC2 4.11e-18 79 32 2 143 3 secB Protein-export protein SecB Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2GE48 5.34e-18 79 33 2 127 3 secB Protein-export protein SecB Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q5HAD9 5.57e-18 79 29 4 156 3 secB Protein-export protein SecB Ehrlichia ruminantium (strain Welgevonden)
A6WX66 6.74e-18 79 29 1 143 3 secB Protein-export protein SecB Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B8GW20 7.03e-18 79 32 1 133 3 secB Protein-export protein SecB Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A224 7.03e-18 79 32 1 133 3 secB Protein-export protein SecB Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A8F0H7 7.6e-18 78 27 2 146 3 secB Protein-export protein SecB Rickettsia massiliae (strain Mtu5)
Q4UNF2 8.28e-18 78 30 3 140 3 secB Protein-export protein SecB Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9ZE76 8.55e-18 78 30 3 140 3 secB Protein-export protein SecB Rickettsia prowazekii (strain Madrid E)
Q2GLM6 8.74e-18 78 30 4 156 3 secB Protein-export protein SecB Anaplasma phagocytophilum (strain HZ)
B0T6F4 1e-17 78 30 1 139 3 secB Protein-export protein SecB Caulobacter sp. (strain K31)
C4K189 1.01e-17 78 30 3 140 3 secB Protein-export protein SecB Rickettsia peacockii (strain Rustic)
A8GQN4 1.06e-17 78 30 3 140 3 secB Protein-export protein SecB Rickettsia rickettsii (strain Sheila Smith)
B0BW24 1.06e-17 78 30 3 140 3 secB Protein-export protein SecB Rickettsia rickettsii (strain Iowa)
Q92JG7 1.1e-17 78 30 3 140 3 secB Protein-export protein SecB Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q2RN91 1.19e-17 78 31 2 122 3 secB Protein-export protein SecB Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
C3PMB1 1.23e-17 77 29 2 131 3 secB Protein-export protein SecB Rickettsia africae (strain ESF-5)
Q11CM1 2.89e-17 77 30 1 140 3 secB Protein-export protein SecB Chelativorans sp. (strain BNC1)
Q5GS95 4.51e-17 76 31 5 158 3 secB Protein-export protein SecB Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q16CY7 6.9e-17 76 30 2 136 3 secB Protein-export protein SecB Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A5CFN0 8.86e-17 75 29 2 139 3 secB Protein-export protein SecB Orientia tsutsugamushi (strain Boryong)
B3CUK7 9.38e-17 75 29 2 139 3 secB Protein-export protein SecB Orientia tsutsugamushi (strain Ikeda)
Q1RGY7 1.37e-16 75 29 3 140 3 secB Protein-export protein SecB Rickettsia bellii (strain RML369-C)
A8GUI7 1.37e-16 75 29 3 140 3 secB Protein-export protein SecB Rickettsia bellii (strain OSU 85-389)
A1B5S4 2.49e-16 75 31 4 145 3 secB Protein-export protein SecB Paracoccus denitrificans (strain Pd 1222)
Q2VYH7 2.61e-16 74 33 3 146 3 secB Protein-export protein SecB Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q5LLN4 6.77e-16 73 29 2 141 3 secB Protein-export protein SecB Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B9KPW0 7.14e-16 73 33 4 142 3 secB Protein-export protein SecB Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3IYG6 7.14e-16 73 33 4 142 3 secB Protein-export protein SecB Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PNT4 7.14e-16 73 33 4 142 3 secB Protein-export protein SecB Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B3CMS4 7.14e-16 73 31 4 150 3 secB Protein-export protein SecB Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Q1GCM7 1.05e-15 73 29 3 151 3 secB Protein-export protein SecB Ruegeria sp. (strain TM1040)
A4WVZ7 1.08e-15 73 33 4 142 3 secB Protein-export protein SecB Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q5FPS3 8.44e-14 68 28 4 147 3 secB1 Protein-export protein SecB 1 Gluconobacter oxydans (strain 621H)
Q28W02 3.29e-13 66 29 4 131 3 secB Protein-export protein SecB Jannaschia sp. (strain CCS1)
A8LPB5 1.99e-12 64 27 2 131 3 secB Protein-export protein SecB Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A9HK92 6.23e-10 58 26 4 140 3 secB Protein-export protein SecB Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q5FNS6 5.36e-06 47 25 4 140 3 secB2 Protein-export protein SecB 2 Gluconobacter oxydans (strain 621H)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17240
Feature type CDS
Gene secB
Product protein-export chaperone SecB
Location 79635 - 80114 (strand: -1)
Length 480 (nucleotides) / 159 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000007
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2208
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02556 Preprotein translocase subunit SecB

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1952 Intracellular trafficking, secretion, and vesicular transport (U) U Preprotein translocase subunit SecB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03071 preprotein translocase subunit SecB Quorum sensing
Protein export
Bacterial secretion system
-

Protein Sequence

MSEQQNTEMSFNIQRVYTKDISFEAPNAPAVFQQDWQPEVKMDLDTGSTKLADDVYEIVLRVTVTATLGEETAFLCEVQQAGIFTIGGLEGTQLAHCLGAYCPNVLFPYARECIAGLVGRGTFPQLNLAPVNFDALFMSYLQQQEEQQAAAPQGGEQEA

Flanking regions ( +/- flanking 50bp)

AACACCCTTTGTAACTCAAACTATTTATAAGGATATCAAAAGGTAACATTATGTCAGAACAACAAAACACAGAAATGTCTTTCAACATTCAGCGCGTCTATACCAAAGACATCTCTTTTGAAGCGCCGAATGCACCTGCAGTTTTCCAGCAGGACTGGCAGCCGGAAGTGAAAATGGATCTGGACACCGGTTCAACCAAACTGGCTGATGATGTCTATGAAATCGTTCTGCGTGTCACTGTAACTGCAACACTGGGCGAAGAAACCGCATTCCTGTGTGAAGTTCAGCAGGCCGGTATTTTCACCATCGGTGGTCTGGAAGGCACTCAGTTAGCACATTGCCTGGGCGCATATTGCCCGAATGTTCTGTTCCCGTATGCCCGTGAGTGCATCGCAGGCTTAGTTGGCCGTGGTACATTCCCGCAGCTGAACCTGGCGCCGGTTAACTTTGATGCCCTGTTTATGAGCTACCTGCAACAGCAGGAAGAGCAGCAGGCAGCCGCACCGCAGGGTGGCGAACAGGAAGCATAATGACAGACGCTTCTATGACTGTACTCGGTGCCGGTTCTTACGGCACCGCT