Homologs in group_2092

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15380 FBDBKF_15380 100.0 Morganella morganii S1 fadR DNA-binding transcriptional regulator, FadR family
EHELCC_15740 EHELCC_15740 100.0 Morganella morganii S2 fadR DNA-binding transcriptional regulator, FadR family
NLDBIP_16630 NLDBIP_16630 100.0 Morganella morganii S4 fadR DNA-binding transcriptional regulator, FadR family
LHKJJB_16175 LHKJJB_16175 100.0 Morganella morganii S3 fadR DNA-binding transcriptional regulator, FadR family
F4V73_RS17765 F4V73_RS17765 91.7 Morganella psychrotolerans - FadR/GntR family transcriptional regulator
PMI_RS15090 PMI_RS15090 58.3 Proteus mirabilis HI4320 - FadR/GntR family transcriptional regulator

Distribution of the homologs in the orthogroup group_2092

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2092

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P31475 2.35e-92 273 57 0 225 4 yieP Uncharacterized HTH-type transcriptional regulator YieP Escherichia coli (strain K12)
P31460 1.45e-24 100 29 2 209 1 dgoR Galactonate operon transcriptional repressor Escherichia coli (strain K12)
P0CL10 1.26e-09 60 27 7 225 3 pdhR Pyruvate dehydrogenase complex repressor Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1W823 1.26e-09 60 27 7 225 3 pdhR Pyruvate dehydrogenase complex repressor Salmonella typhimurium (strain SL1344)
P0A2S3 1.26e-09 60 27 7 225 3 pdhR Pyruvate dehydrogenase complex repressor Salmonella typhi
P0ACL9 1.59e-09 59 27 7 225 1 pdhR Pyruvate dehydrogenase complex repressor Escherichia coli (strain K12)
P0ACM0 1.59e-09 59 27 7 225 3 pdhR Pyruvate dehydrogenase complex repressor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACM1 1.59e-09 59 27 7 225 3 pdhR Pyruvate dehydrogenase complex repressor Escherichia coli O157:H7
G0E1Z6 9.25e-09 57 28 10 241 3 nanR HTH-type transcriptional repressor NanR Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / CCUG 1429 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006 / CDC 819-56)
Q3YX22 8.17e-08 55 26 7 231 3 nanR HTH-type transcriptional repressor NanR Shigella sonnei (strain Ss046)
P67735 9.43e-08 54 27 9 236 3 nanR HTH-type transcriptional repressor NanR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67736 9.43e-08 54 27 9 236 3 nanR HTH-type transcriptional repressor NanR Salmonella typhi
B5BGP6 9.43e-08 54 27 9 236 3 nanR HTH-type transcriptional repressor NanR Salmonella paratyphi A (strain AKU_12601)
C0PZN5 9.43e-08 54 27 9 236 3 nanR HTH-type transcriptional repressor NanR Salmonella paratyphi C (strain RKS4594)
Q5PJS9 9.43e-08 54 27 9 236 3 nanR HTH-type transcriptional repressor NanR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5RET8 9.43e-08 54 27 9 236 3 nanR HTH-type transcriptional repressor NanR Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0L3 9.43e-08 54 27 9 236 3 nanR HTH-type transcriptional repressor NanR Salmonella enteritidis PT4 (strain P125109)
Q57JC8 9.43e-08 54 27 9 236 3 nanR HTH-type transcriptional repressor NanR Salmonella choleraesuis (strain SC-B67)
A9MNY5 9.89e-08 54 27 9 236 3 nanR HTH-type transcriptional repressor NanR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
F8VI19 1.04e-07 54 26 8 235 3 nanR HTH-type transcriptional repressor NanR Salmonella bongori (strain ATCC 43975 / DSM 13772 / NCTC 12419)
B4TWJ1 1.06e-07 54 26 9 241 3 nanR HTH-type transcriptional repressor NanR Salmonella schwarzengrund (strain CVM19633)
B4T751 1.13e-07 54 27 9 236 3 nanR HTH-type transcriptional repressor NanR Salmonella newport (strain SL254)
P0ACL8 1.31e-07 54 26 6 215 3 lldR Putative L-lactate dehydrogenase operon regulatory protein Shigella flexneri
P0ACL7 1.31e-07 54 26 6 215 2 lldR Putative L-lactate dehydrogenase operon regulatory protein Escherichia coli (strain K12)
D2TP58 1.36e-07 54 27 9 237 3 nanR HTH-type transcriptional repressor NanR Citrobacter rodentium (strain ICC168)
B0TRI9 1.59e-07 53 24 6 214 3 fadR Fatty acid metabolism regulator protein Shewanella halifaxensis (strain HAW-EB4)
P67742 2.33e-07 53 52 0 48 4 BQ2027_MB0601 Uncharacterized HTH-type transcriptional regulator Mb0601 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMG5 2.33e-07 53 52 0 48 1 mce2R HTH-type transcriptional regulator Mce2R Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMG4 2.33e-07 53 52 0 48 3 mce2R HTH-type transcriptional regulator Mce2R Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q32BB3 2.35e-07 53 27 8 233 3 nanR HTH-type transcriptional repressor NanR Shigella dysenteriae serotype 1 (strain Sd197)
P0A8W1 2.38e-07 53 27 8 233 3 nanR HTH-type transcriptional repressor NanR Shigella flexneri
Q31W95 2.38e-07 53 27 8 233 3 nanR HTH-type transcriptional repressor NanR Shigella boydii serotype 4 (strain Sb227)
P0A8W0 2.38e-07 53 27 8 233 1 nanR HTH-type transcriptional repressor NanR Escherichia coli (strain K12)
B1IQQ3 2.38e-07 53 27 8 233 3 nanR HTH-type transcriptional repressor NanR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XHJ9 2.38e-07 53 27 8 233 3 nanR HTH-type transcriptional repressor NanR Escherichia coli (strain K12 / DH10B)
C4ZSW4 2.38e-07 53 27 8 233 3 nanR HTH-type transcriptional repressor NanR Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0T8 2.38e-07 53 27 8 233 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O8 (strain IAI1)
A7MJD3 2.69e-07 53 27 9 238 3 nanR HTH-type transcriptional repressor NanR Cronobacter sakazakii (strain ATCC BAA-894)
B7UJV9 3.51e-07 53 26 7 231 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A8H5C1 3.6e-07 52 25 4 201 3 fadR Fatty acid metabolism regulator protein Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B7NKT7 3.86e-07 52 26 7 231 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7NDK4 3.97e-07 52 26 7 231 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B6I1U4 4.2e-07 52 26 8 236 3 nanR HTH-type transcriptional repressor NanR Escherichia coli (strain SE11)
Q8X4W4 4.2e-07 52 26 8 236 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O157:H7
B7LHT2 4.2e-07 52 26 8 236 3 nanR HTH-type transcriptional repressor NanR Escherichia coli (strain 55989 / EAEC)
Q1R6B4 4.28e-07 52 26 7 231 3 nanR HTH-type transcriptional repressor NanR Escherichia coli (strain UTI89 / UPEC)
Q8FD57 4.28e-07 52 26 7 231 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCP0 4.28e-07 52 26 7 231 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGC0 4.28e-07 52 26 7 231 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O1:K1 / APEC
B7N0Z9 4.28e-07 52 26 7 231 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O81 (strain ED1a)
B7MBY8 4.28e-07 52 26 7 231 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O45:K1 (strain S88 / ExPEC)
A4WF39 4.54e-07 52 28 8 231 3 nanR HTH-type transcriptional repressor NanR Enterobacter sp. (strain 638)
Q9X9E0 8.7e-07 52 37 1 85 4 exuR Exu regulon transcriptional regulator Dickeya chrysanthemi
C5B9W3 2.52e-06 50 26 3 165 3 fadR Fatty acid metabolism regulator protein Edwardsiella ictaluri (strain 93-146)
B4EXU3 3.26e-06 50 27 6 176 3 fadR Fatty acid metabolism regulator protein Proteus mirabilis (strain HI4320)
P67740 4.06e-06 49 30 1 122 4 BQ2027_MB0505 Uncharacterized HTH-type transcriptional regulator Mb0505 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMG7 4.06e-06 49 30 1 122 1 Rv0494 Uncharacterized HTH-type transcriptional regulator Rv0494 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMG6 4.06e-06 49 30 1 122 4 MT0514 Uncharacterized HTH-type transcriptional regulator MT0514 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P31453 8.77e-06 48 43 0 58 4 yidP Uncharacterized HTH-type transcriptional regulator YidP Escherichia coli (strain K12)
E0T5H9 9.16e-06 48 26 8 234 3 nanR HTH-type transcriptional repressor NanR Edwardsiella tarda (strain FL6-60)
P32425 9.25e-06 48 24 5 213 4 None Uncharacterized HTH-type transcriptional regulator in unstable DNA locus Streptomyces ambofaciens
Q7N3Z5 1.07e-05 48 47 0 46 3 fadR Fatty acid metabolism regulator protein Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q0HW67 1.13e-05 48 26 8 210 3 fadR Fatty acid metabolism regulator protein Shewanella sp. (strain MR-7)
Q8ED80 1.26e-05 48 26 8 203 3 fadR Fatty acid metabolism regulator protein Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HJX1 1.37e-05 48 26 8 210 3 fadR Fatty acid metabolism regulator protein Shewanella sp. (strain MR-4)
Q87N05 1.39e-05 48 48 1 49 3 fadR Fatty acid metabolism regulator protein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P39796 1.53e-05 48 47 0 46 1 treR HTH-type transcriptional regulator TreR Bacillus subtilis (strain 168)
Q7MJP0 1.57e-05 48 50 0 42 3 fadR Fatty acid metabolism regulator protein Vibrio vulnificus (strain YJ016)
Q8DAG8 1.57e-05 48 50 0 42 3 fadR Fatty acid metabolism regulator protein Vibrio vulnificus (strain CMCP6)
A0KVP9 1.67e-05 48 26 8 203 3 fadR Fatty acid metabolism regulator protein Shewanella sp. (strain ANA-3)
O31761 1.99e-05 47 33 0 69 4 ymfC Uncharacterized HTH-type transcriptional regulator YmfC Bacillus subtilis (strain 168)
C3LNK4 2.09e-05 47 50 0 42 3 fadR Fatty acid metabolism regulator protein Vibrio cholerae serotype O1 (strain M66-2)
Q9KQU8 2.09e-05 47 50 0 42 1 fadR Fatty acid metabolism regulator protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F6Z2 2.09e-05 47 50 0 42 3 fadR Fatty acid metabolism regulator protein Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
O34817 2.34e-05 47 44 0 52 1 nagR HTH-type transcriptional repressor NagR Bacillus subtilis (strain 168)
A9KY80 2.5e-05 47 25 8 210 3 fadR Fatty acid metabolism regulator protein Shewanella baltica (strain OS195)
A6WM75 2.5e-05 47 25 8 210 3 fadR Fatty acid metabolism regulator protein Shewanella baltica (strain OS185)
B8EAH2 2.62e-05 47 25 8 210 3 fadR Fatty acid metabolism regulator protein Shewanella baltica (strain OS223)
A3D3H2 2.72e-05 47 25 8 210 3 fadR Fatty acid metabolism regulator protein Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q083H2 2.95e-05 47 27 9 191 3 fadR Fatty acid metabolism regulator protein Shewanella frigidimarina (strain NCIMB 400)
P44487 3.39e-05 47 25 7 214 3 uxuR Uxu operon regulator Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O07007 3.72e-05 47 27 7 213 1 lutR HTH-type transcriptional regulator LutR Bacillus subtilis (strain 168)
A4Y625 5.73e-05 46 25 8 210 3 fadR Fatty acid metabolism regulator protein Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q12NQ7 7.49e-05 46 48 1 49 3 fadR Fatty acid metabolism regulator protein Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8GAL4 9.04e-05 45 25 5 198 2 gntR Probable D-xylose utilization operon transcriptional repressor Paenarthrobacter nicotinovorans
C6DG46 9.21e-05 45 45 0 46 3 fadR Fatty acid metabolism regulator protein Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D4N0 9.21e-05 45 45 0 46 3 fadR Fatty acid metabolism regulator protein Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6TAW6 9.29e-05 45 45 0 46 3 fadR Fatty acid metabolism regulator protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XQ79 9.47e-05 45 45 0 46 3 fadR Fatty acid metabolism regulator protein Klebsiella pneumoniae (strain 342)
A1S6X3 9.88e-05 45 25 8 211 3 fadR Fatty acid metabolism regulator protein Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B1JLH6 0.000105 45 45 0 46 3 fadR Fatty acid metabolism regulator protein Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66AQ8 0.000105 45 45 0 46 3 fadR Fatty acid metabolism regulator protein Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TJC6 0.000105 45 45 0 46 3 fadR Fatty acid metabolism regulator protein Yersinia pestis (strain Pestoides F)
Q1CJ88 0.000105 45 45 0 46 3 fadR Fatty acid metabolism regulator protein Yersinia pestis bv. Antiqua (strain Nepal516)
A9R9D5 0.000105 45 45 0 46 3 fadR Fatty acid metabolism regulator protein Yersinia pestis bv. Antiqua (strain Angola)
Q8ZEL9 0.000105 45 45 0 46 3 fadR Fatty acid metabolism regulator protein Yersinia pestis
B2K3Q1 0.000105 45 45 0 46 3 fadR Fatty acid metabolism regulator protein Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C7V2 0.000105 45 45 0 46 3 fadR Fatty acid metabolism regulator protein Yersinia pestis bv. Antiqua (strain Antiqua)
A7FI94 0.000105 45 45 0 46 3 fadR Fatty acid metabolism regulator protein Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A7MKD4 0.000107 45 45 0 46 3 fadR Fatty acid metabolism regulator protein Cronobacter sakazakii (strain ATCC BAA-894)
B2VJ49 0.000117 45 45 0 46 3 fadR Fatty acid metabolism regulator protein Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q9CPJ0 0.000166 45 44 0 49 3 fadR Fatty acid metabolism regulator protein Pasteurella multocida (strain Pm70)
P70790 0.000172 44 28 6 147 4 None Uncharacterized HTH-type transcriptional regulator in the TAR-I ttuE-ttuC' intergenic region Agrobacterium vitis
C0Q329 0.000195 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Salmonella paratyphi C (strain RKS4594)
A8GFF9 0.000198 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Serratia proteamaculans (strain 568)
A1JQP6 0.000214 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8ZP15 0.000222 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TXX5 0.000222 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Salmonella schwarzengrund (strain CVM19633)
B5BI48 0.000222 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Salmonella paratyphi A (strain AKU_12601)
A9MVW4 0.000222 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PCU3 0.000222 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUJ7 0.000222 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Salmonella newport (strain SL254)
B4TKD5 0.000222 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Salmonella heidelberg (strain SL476)
B5R8Z6 0.000222 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2W5 0.000222 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Salmonella enteritidis PT4 (strain P125109)
B5FTM9 0.000222 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Salmonella dublin (strain CT_02021853)
B5F4E2 0.000222 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Salmonella agona (strain SL483)
A9MP58 0.000235 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q3Z2W1 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Shigella sonnei (strain Ss046)
P0A8V9 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Shigella flexneri
Q32H29 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Shigella dysenteriae serotype 1 (strain Sd197)
Q31ZM8 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Shigella boydii serotype 4 (strain Sb227)
B2TZB3 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RCQ9 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli (strain UTI89 / UPEC)
B1LHY0 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli (strain SMS-3-5 / SECEC)
B6I9P8 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli (strain SE11)
B7N3Z1 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8V6 0.000237 44 43 0 46 1 fadR Fatty acid metabolism regulator protein Escherichia coli (strain K12)
B1IUA5 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8V7 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TII8 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AAB0 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli O1:K1 / APEC
A7ZZC1 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli O9:H4 (strain HS)
B1XA74 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli (strain K12 / DH10B)
C4ZTM8 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli (strain K12 / MC4100 / BW2952)
B7LXA1 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli O8 (strain IAI1)
B7MTW5 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli O81 (strain ED1a)
B7NJF3 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YXL1 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8V8 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli O157:H7
B7LGU7 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli (strain 55989 / EAEC)
B7MK84 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UQ71 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZKV8 0.000237 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LSJ7 0.000265 44 43 0 46 3 fadR Fatty acid metabolism regulator protein Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P42239 0.000277 44 22 4 203 4 ycbG Uncharacterized HTH-type transcriptional regulator YcbG Bacillus subtilis (strain 168)
P0ACL5 0.000371 43 24 7 213 1 glcC Glc operon transcriptional activator Escherichia coli (strain K12)
P0ACL6 0.000371 43 24 7 213 3 glcC Glc operon transcriptional activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P39161 0.000614 43 45 0 53 4 uxuR Uxu operon transcriptional regulator Escherichia coli (strain K12)
P0ACM8 0.001 42 30 1 85 4 yegW Uncharacterized HTH-type transcriptional regulator YegW Shigella flexneri
P0ACM5 0.001 42 30 1 85 4 yegW Uncharacterized HTH-type transcriptional regulator YegW Escherichia coli (strain K12)
P0ACM6 0.001 42 30 1 85 4 yegW Uncharacterized HTH-type transcriptional regulator YegW Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACM7 0.001 42 30 1 85 4 yegW Uncharacterized HTH-type transcriptional regulator YegW Escherichia coli O157:H7
Q8Z685 0.001 42 43 0 46 3 fadR Fatty acid metabolism regulator protein Salmonella typhi

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_15945
Feature type CDS
Gene fadR
Product DNA-binding transcriptional regulator, FadR family
Location 378 - 1064 (strand: 1)
Length 687 (nucleotides) / 228 (amino acids)
In genomic island -

Contig

Accession ZDB_696
Length 80662 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2092
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00392 Bacterial regulatory proteins, gntR family
PF07729 FCD domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2186 Transcription (K) K DNA-binding transcriptional regulator, FadR family

Protein Sequence

MQFSEQLNASQKNLSYLLAEKLGQQILSGKYPPESILPGEIELAEQFGVSRTAVREAVKMLAAKGMVLPRPRIGTRVMPVISWNFLDHDFIKWWLSSGDHRQVLTYFRELRAAIEPQACALAAMNAGKDQKQSLSFLLKEMTLLSAHFERDKWIAVDHRFHHLIYQACGNPFFSSFANLFDFVYHNFFESITTNQVIEIDLHKEIVDAIIDGNGERARQACQVLLSKV

Flanking regions ( +/- flanking 50bp)

CTTATATATCATTATCCCGCTTTGTTAATGCATCACACCAAGGAATCAGAATGCAGTTTTCAGAACAACTCAATGCGTCACAAAAGAACCTGTCTTATCTTCTGGCTGAAAAACTGGGACAGCAGATTTTATCCGGCAAGTATCCGCCGGAATCTATTTTGCCGGGAGAGATTGAGTTGGCGGAGCAGTTCGGGGTAAGCCGGACCGCTGTCCGTGAGGCAGTAAAAATGCTGGCGGCGAAAGGAATGGTTTTACCGCGCCCGCGCATCGGCACCCGGGTGATGCCGGTGATAAGCTGGAATTTTCTCGACCATGACTTTATTAAGTGGTGGCTGAGCAGCGGAGACCACCGGCAGGTACTGACGTATTTCCGCGAGCTGCGCGCCGCGATTGAACCCCAGGCCTGCGCACTGGCCGCCATGAATGCCGGAAAAGATCAGAAACAGTCACTTTCGTTTCTGTTAAAAGAGATGACCTTATTATCCGCCCATTTTGAGCGGGATAAATGGATAGCCGTTGATCACCGCTTCCACCACCTTATTTACCAGGCGTGCGGAAATCCGTTCTTTTCCTCTTTCGCCAATTTATTTGATTTTGTGTATCACAACTTTTTTGAATCCATCACCACCAATCAGGTTATTGAGATTGATCTCCACAAGGAGATTGTGGATGCCATTATCGACGGGAACGGAGAACGCGCCCGTCAGGCATGTCAGGTGTTGTTGAGTAAAGTGTGAATATGTAATAGTTACACTACTGACTATTCATAGATAATGCATTAAGGGAA