Homologs in group_2053

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15380 FBDBKF_15380 91.7 Morganella morganii S1 fadR DNA-binding transcriptional regulator, FadR family
EHELCC_15740 EHELCC_15740 91.7 Morganella morganii S2 fadR DNA-binding transcriptional regulator, FadR family
NLDBIP_16630 NLDBIP_16630 91.7 Morganella morganii S4 fadR DNA-binding transcriptional regulator, FadR family
LHKJJB_16175 LHKJJB_16175 91.7 Morganella morganii S3 fadR DNA-binding transcriptional regulator, FadR family
HKOGLL_15945 HKOGLL_15945 91.7 Morganella morganii S5 fadR DNA-binding transcriptional regulator, FadR family
PMI_RS15090 PMI_RS15090 58.8 Proteus mirabilis HI4320 - FadR/GntR family transcriptional regulator

Distribution of the homologs in the orthogroup group_2053

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2053

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P31475 5.55e-90 267 56 0 225 4 yieP Uncharacterized HTH-type transcriptional regulator YieP Escherichia coli (strain K12)
P31460 7.56e-24 98 29 2 209 1 dgoR Galactonate operon transcriptional repressor Escherichia coli (strain K12)
G0E1Z6 1.88e-10 62 30 8 236 3 nanR HTH-type transcriptional repressor NanR Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / CCUG 1429 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006 / CDC 819-56)
P0ACL9 6.55e-10 60 29 8 224 1 pdhR Pyruvate dehydrogenase complex repressor Escherichia coli (strain K12)
P0ACM0 6.55e-10 60 29 8 224 3 pdhR Pyruvate dehydrogenase complex repressor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACM1 6.55e-10 60 29 8 224 3 pdhR Pyruvate dehydrogenase complex repressor Escherichia coli O157:H7
P0CL10 1.22e-09 60 28 8 225 3 pdhR Pyruvate dehydrogenase complex repressor Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1W823 1.22e-09 60 28 8 225 3 pdhR Pyruvate dehydrogenase complex repressor Salmonella typhimurium (strain SL1344)
P0A2S3 1.22e-09 60 28 8 225 3 pdhR Pyruvate dehydrogenase complex repressor Salmonella typhi
A7MJD3 1.15e-08 57 28 9 237 3 nanR HTH-type transcriptional repressor NanR Cronobacter sakazakii (strain ATCC BAA-894)
F8VI19 1.49e-08 57 27 9 242 3 nanR HTH-type transcriptional repressor NanR Salmonella bongori (strain ATCC 43975 / DSM 13772 / NCTC 12419)
A9MNY5 1.93e-08 56 27 9 237 3 nanR HTH-type transcriptional repressor NanR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q32BB3 2e-08 56 27 9 238 3 nanR HTH-type transcriptional repressor NanR Shigella dysenteriae serotype 1 (strain Sd197)
B4TWJ1 2.02e-08 56 27 9 242 3 nanR HTH-type transcriptional repressor NanR Salmonella schwarzengrund (strain CVM19633)
P0A8W1 2.1e-08 56 27 9 238 3 nanR HTH-type transcriptional repressor NanR Shigella flexneri
Q31W95 2.1e-08 56 27 9 238 3 nanR HTH-type transcriptional repressor NanR Shigella boydii serotype 4 (strain Sb227)
P0A8W0 2.1e-08 56 27 9 238 1 nanR HTH-type transcriptional repressor NanR Escherichia coli (strain K12)
B1IQQ3 2.1e-08 56 27 9 238 3 nanR HTH-type transcriptional repressor NanR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XHJ9 2.1e-08 56 27 9 238 3 nanR HTH-type transcriptional repressor NanR Escherichia coli (strain K12 / DH10B)
C4ZSW4 2.1e-08 56 27 9 238 3 nanR HTH-type transcriptional repressor NanR Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0T8 2.1e-08 56 27 9 238 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O8 (strain IAI1)
P67735 2.14e-08 56 27 9 237 3 nanR HTH-type transcriptional repressor NanR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67736 2.14e-08 56 27 9 237 3 nanR HTH-type transcriptional repressor NanR Salmonella typhi
B5BGP6 2.14e-08 56 27 9 237 3 nanR HTH-type transcriptional repressor NanR Salmonella paratyphi A (strain AKU_12601)
C0PZN5 2.14e-08 56 27 9 237 3 nanR HTH-type transcriptional repressor NanR Salmonella paratyphi C (strain RKS4594)
Q5PJS9 2.14e-08 56 27 9 237 3 nanR HTH-type transcriptional repressor NanR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5RET8 2.14e-08 56 27 9 237 3 nanR HTH-type transcriptional repressor NanR Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0L3 2.14e-08 56 27 9 237 3 nanR HTH-type transcriptional repressor NanR Salmonella enteritidis PT4 (strain P125109)
Q57JC8 2.14e-08 56 27 9 237 3 nanR HTH-type transcriptional repressor NanR Salmonella choleraesuis (strain SC-B67)
B4T751 2.35e-08 56 27 9 242 3 nanR HTH-type transcriptional repressor NanR Salmonella newport (strain SL254)
Q3YX22 2.69e-08 56 28 8 231 3 nanR HTH-type transcriptional repressor NanR Shigella sonnei (strain Ss046)
B7NKT7 3.59e-08 55 27 8 236 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7NDK4 3.99e-08 55 27 8 236 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B6I1U4 4.03e-08 55 27 8 236 3 nanR HTH-type transcriptional repressor NanR Escherichia coli (strain SE11)
Q8X4W4 4.03e-08 55 27 8 236 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O157:H7
B7LHT2 4.03e-08 55 27 8 236 3 nanR HTH-type transcriptional repressor NanR Escherichia coli (strain 55989 / EAEC)
Q1R6B4 4.19e-08 55 27 8 236 3 nanR HTH-type transcriptional repressor NanR Escherichia coli (strain UTI89 / UPEC)
Q8FD57 4.19e-08 55 27 8 236 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCP0 4.19e-08 55 27 8 236 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGC0 4.19e-08 55 27 8 236 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O1:K1 / APEC
B7N0Z9 4.19e-08 55 27 8 236 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O81 (strain ED1a)
B7MBY8 4.19e-08 55 27 8 236 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJV9 4.23e-08 55 27 8 236 3 nanR HTH-type transcriptional repressor NanR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A4WF39 4.56e-08 55 29 7 231 3 nanR HTH-type transcriptional repressor NanR Enterobacter sp. (strain 638)
D2TP58 8.58e-08 54 27 10 242 3 nanR HTH-type transcriptional repressor NanR Citrobacter rodentium (strain ICC168)
E0T5H9 2.96e-06 50 26 9 241 3 nanR HTH-type transcriptional repressor NanR Edwardsiella tarda (strain FL6-60)
P0ACL8 5.72e-06 49 26 7 214 3 lldR Putative L-lactate dehydrogenase operon regulatory protein Shigella flexneri
P0ACL7 5.72e-06 49 26 7 214 2 lldR Putative L-lactate dehydrogenase operon regulatory protein Escherichia coli (strain K12)
Q8GAL4 8.41e-06 48 26 4 183 2 gntR Probable D-xylose utilization operon transcriptional repressor Paenarthrobacter nicotinovorans
Q9X9E0 1.09e-05 48 29 6 170 4 exuR Exu regulon transcriptional regulator Dickeya chrysanthemi
B0TRI9 2.23e-05 47 23 6 213 3 fadR Fatty acid metabolism regulator protein Shewanella halifaxensis (strain HAW-EB4)
P67742 2.97e-05 47 47 0 48 4 BQ2027_MB0601 Uncharacterized HTH-type transcriptional regulator Mb0601 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMG5 2.97e-05 47 47 0 48 1 mce2R HTH-type transcriptional regulator Mce2R Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMG4 2.97e-05 47 47 0 48 3 mce2R HTH-type transcriptional regulator Mce2R Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
C5B9W3 7.7e-05 46 24 4 174 3 fadR Fatty acid metabolism regulator protein Edwardsiella ictaluri (strain 93-146)
P42239 7.88e-05 45 23 4 203 4 ycbG Uncharacterized HTH-type transcriptional regulator YcbG Bacillus subtilis (strain 168)
P31453 9.87e-05 45 41 0 58 4 yidP Uncharacterized HTH-type transcriptional regulator YidP Escherichia coli (strain K12)
P32425 0.000103 45 24 5 213 4 None Uncharacterized HTH-type transcriptional regulator in unstable DNA locus Streptomyces ambofaciens
A8H5C1 0.000166 45 23 7 211 3 fadR Fatty acid metabolism regulator protein Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
O07007 0.000218 44 27 7 213 1 lutR HTH-type transcriptional regulator LutR Bacillus subtilis (strain 168)
P39796 0.000266 44 45 0 46 1 treR HTH-type transcriptional regulator TreR Bacillus subtilis (strain 168)
Q8ED80 0.000369 43 25 8 203 3 fadR Fatty acid metabolism regulator protein Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9KY80 0.000405 43 23 7 202 3 fadR Fatty acid metabolism regulator protein Shewanella baltica (strain OS195)
A6WM75 0.000405 43 23 7 202 3 fadR Fatty acid metabolism regulator protein Shewanella baltica (strain OS185)
B8EAH2 0.000417 43 23 7 202 3 fadR Fatty acid metabolism regulator protein Shewanella baltica (strain OS223)
Q7N3Z5 0.000439 43 26 4 168 3 fadR Fatty acid metabolism regulator protein Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A3D3H2 0.000471 43 23 7 202 3 fadR Fatty acid metabolism regulator protein Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q0HW67 0.000534 43 25 8 203 3 fadR Fatty acid metabolism regulator protein Shewanella sp. (strain MR-7)
Q0HJX1 0.000564 43 25 8 203 3 fadR Fatty acid metabolism regulator protein Shewanella sp. (strain MR-4)
A0KVP9 0.000586 43 24 7 197 3 fadR Fatty acid metabolism regulator protein Shewanella sp. (strain ANA-3)
Q9CPJ0 0.00062 43 42 0 49 3 fadR Fatty acid metabolism regulator protein Pasteurella multocida (strain Pm70)
P67740 0.00075 43 28 1 122 4 BQ2027_MB0505 Uncharacterized HTH-type transcriptional regulator Mb0505 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMG7 0.00075 43 28 1 122 1 Rv0494 Uncharacterized HTH-type transcriptional regulator Rv0494 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMG6 0.00075 43 28 1 122 4 MT0514 Uncharacterized HTH-type transcriptional regulator MT0514 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A1S6X3 0.001 42 24 5 172 3 fadR Fatty acid metabolism regulator protein Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17765
Feature type CDS
Gene -
Product FadR/GntR family transcriptional regulator
Location 195389 - 196075 (strand: -1)
Length 687 (nucleotides) / 228 (amino acids)

Contig

Accession term accessions NZ_VXKB01000007 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2053
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00392 Bacterial regulatory proteins, gntR family
PF07729 FCD domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2186 Transcription (K) K DNA-binding transcriptional regulator, FadR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05799 GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex - -

Protein Sequence

MQFSEQLNASQKNLSYLLAEKLGKQILSGHYPPESILPGEIELAAQFEVSRTAVREAVKMLAAKGMVLPRPRIGTRVMPTISWNFLDHDFIKWWLSSGDQRRVLTYFRELRIAIEPQACALAAVNAAKEQKQSLSFLLKEMTLLSDDFEREKWIAVDHRFHHLIYQACGNPFFASFANLFDFVYHNFFESITTNQVIEVDLHKEIVDAILDGNGERARHACQLLLSKV

Flanking regions ( +/- flanking 50bp)

CTTATTAGTCATTCTCCTGCTTTGTTAATGCATCACGTCAAGGAATCCGAATGCAGTTTTCAGAACAACTCAACGCCTCACAAAAGAATCTGTCCTATCTTCTGGCCGAAAAACTGGGAAAACAGATTTTATCCGGTCACTATCCGCCTGAATCTATATTGCCGGGTGAGATTGAGCTGGCGGCTCAATTTGAAGTCAGCCGGACCGCTGTCCGTGAAGCCGTCAAGATGCTGGCGGCGAAAGGGATGGTGTTACCCCGCCCACGCATCGGAACCCGGGTTATGCCAACCATCAGCTGGAATTTTCTTGATCACGATTTTATTAAATGGTGGCTGAGCAGTGGTGACCAACGCCGGGTACTGACGTATTTCCGCGAGCTGCGTATCGCCATTGAGCCACAAGCCTGTGCACTGGCGGCTGTTAATGCCGCCAAAGAACAAAAACAGTCTCTTTCTTTTCTTTTAAAGGAGATGACATTGTTGTCAGATGATTTTGAGCGCGAAAAATGGATTGCTGTTGATCACCGCTTTCACCATTTGATTTATCAGGCATGCGGAAATCCGTTCTTTGCCTCTTTCGCCAATTTATTCGATTTTGTGTATCACAACTTTTTTGAATCCATCACGACAAACCAGGTAATAGAGGTTGATCTCCATAAAGAGATAGTGGATGCCATTCTTGATGGTAATGGTGAGCGGGCCCGCCATGCTTGTCAGTTGTTGTTGAGCAAGGTATGAATGTGTAATAGTCACGTTCATGACTGTTCATTAATAGCTATATAGTAGTG