Homologs in group_1973

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14800 FBDBKF_14800 100.0 Morganella morganii S1 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
EHELCC_15605 EHELCC_15605 100.0 Morganella morganii S2 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
NLDBIP_16135 NLDBIP_16135 100.0 Morganella morganii S4 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
LHKJJB_15705 LHKJJB_15705 100.0 Morganella morganii S3 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
F4V73_RS07600 F4V73_RS07600 88.9 Morganella psychrotolerans - ABC transporter ATP-binding protein
PMI_RS01115 PMI_RS01115 66.2 Proteus mirabilis HI4320 - ABC transporter ATP-binding protein

Distribution of the homologs in the orthogroup group_1973

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1973

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q57554 7.45e-48 162 38 7 251 3 MJ0089 Uncharacterized ABC transporter ATP-binding protein MJ0089 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P07821 6.95e-42 147 34 5 257 1 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Escherichia coli (strain K12)
O32188 1.88e-41 146 36 5 244 1 yusV Probable siderophore transport system ATP-binding protein YusV Bacillus subtilis (strain 168)
P49938 3.85e-40 143 35 5 244 3 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Bacillus subtilis (strain 168)
Q47087 2.92e-39 140 34 3 243 3 cbrD Achromobactin transport ATP-binding protein CbrD Dickeya dadantii (strain 3937)
Q81V82 5.93e-39 140 36 6 247 1 fpuD Petrobactin import ATP-binding protein FpuD Bacillus anthracis
P23878 1.5e-37 136 32 3 241 1 fepC Ferric enterobactin transport ATP-binding protein FepC Escherichia coli (strain K12)
Q6D734 1.27e-35 133 34 4 225 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7AH43 3.02e-35 132 33 4 226 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli O157:H7
Q7NN36 3.07e-35 130 36 6 234 3 hmuV Hemin import ATP-binding protein HmuV Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q81LM1 3.14e-35 130 34 3 229 1 fpuC Petrobactin import ATP-binding protein FpuC Bacillus anthracis
P94420 4.67e-34 127 31 4 234 1 yclP Petrobactin import ATP-binding protein YclP Bacillus subtilis (strain 168)
Q93SS1 5.53e-34 127 34 6 246 3 hmuV Hemin import ATP-binding protein HmuV Plesiomonas shigelloides
Q2SB47 5.67e-34 126 35 8 250 3 hmuV Hemin import ATP-binding protein HmuV Hahella chejuensis (strain KCTC 2396)
P15031 1.06e-33 125 35 6 242 1 fecE Fe(3+) dicitrate transport ATP-binding protein FecE Escherichia coli (strain K12)
Q8EB59 5.06e-33 124 35 5 229 3 hmuV Hemin import ATP-binding protein HmuV Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P10091 5.24e-33 127 38 3 197 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Marchantia polymorpha
Q2T3B8 5.93e-33 124 33 5 271 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q81GU1 3.33e-32 124 34 4 241 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
O31339 3.33e-32 124 34 4 241 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q160G4 4.22e-32 122 35 4 220 3 hmuV Hemin import ATP-binding protein HmuV Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q1R597 4.64e-32 121 34 6 229 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli (strain UTI89 / UPEC)
Q32AY3 4.79e-32 121 34 7 247 3 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae serotype 1 (strain Sd197)
Q12R52 4.97e-32 121 32 5 256 3 hmuV Hemin import ATP-binding protein HmuV Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8FCJ1 7.55e-32 121 34 6 229 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBU8 7.55e-32 121 34 6 229 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q57293 7.85e-32 123 31 4 241 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Actinobacillus pleuropneumoniae
O70014 8.39e-32 120 34 7 247 1 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae
Q87J32 9.11e-32 121 29 5 254 3 hmuV Hemin import ATP-binding protein HmuV Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
O34510 1.07e-31 120 33 4 243 3 yfmF Fe(3+)-citrate import ATP-binding protein YfmF Bacillus subtilis (strain 168)
Q0I2Z4 1.1e-31 122 32 6 231 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Histophilus somni (strain 129Pt)
P37009 1.31e-31 122 31 4 226 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli (strain K12)
Q8E8K8 1.49e-31 122 33 4 250 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q39B28 1.56e-31 120 33 5 254 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q2NSR0 2.31e-31 120 33 6 253 3 hmuV Hemin import ATP-binding protein HmuV Sodalis glossinidius (strain morsitans)
Q8CUY0 2.4e-31 119 31 7 244 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9KLQ5 3.59e-31 121 31 5 235 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q3ICT8 4.59e-31 119 34 9 255 3 hmuV Hemin import ATP-binding protein HmuV Pseudoalteromonas translucida (strain TAC 125)
Q6LKD4 5.21e-31 121 32 5 227 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photobacterium profundum (strain SS9)
Q66FK0 6.22e-31 119 32 6 257 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CE65 6.22e-31 119 32 6 257 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Nepal516)
Q56993 6.22e-31 119 32 6 257 1 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis
Q1C0Q8 6.22e-31 119 32 6 257 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Antiqua)
P44531 7.4e-31 120 31 5 235 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q88DY1 8.02e-31 118 34 5 239 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q6F9A8 8.88e-31 120 34 4 246 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q8X5N2 1.01e-30 118 33 6 229 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O157:H7
Q5YVL8 1.25e-30 119 35 5 235 3 hmuV Hemin import ATP-binding protein HmuV Nocardia farcinica (strain IFM 10152)
Q88YN5 1.29e-30 117 33 3 206 3 phnC Phosphonates import ATP-binding protein PhnC Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q28QF9 1.35e-30 118 33 5 226 3 hmuV Hemin import ATP-binding protein HmuV Jannaschia sp. (strain CCS1)
Q7N8B9 1.38e-30 120 31 6 257 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8F6Z1 1.48e-30 120 31 4 242 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PE5 1.48e-30 120 31 4 242 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q62K82 1.83e-30 119 35 5 237 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q63TY1 2.14e-30 119 35 5 237 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q6D645 2.2e-30 117 32 5 254 3 hmuV Hemin import ATP-binding protein HmuV Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8L1U3 2.43e-30 117 33 4 243 1 hmuV Hemin import ATP-binding protein HmuV Bordetella avium
Q2KUC0 2.43e-30 117 33 4 243 3 hmuV Hemin import ATP-binding protein HmuV Bordetella avium (strain 197N)
P45092 2.49e-30 117 31 4 235 3 artP Arginine transport ATP-binding protein ArtP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q98L75 3.48e-30 117 31 6 236 3 hmuV Hemin import ATP-binding protein HmuV Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8XZP8 4.57e-30 119 33 5 242 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q03AH0 4.98e-30 119 33 4 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q7N6Z2 5.76e-30 118 31 5 247 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1BJA5 5.9e-30 116 32 6 275 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia orbicola (strain AU 1054)
A0B3E2 5.9e-30 116 32 6 275 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia cenocepacia (strain HI2424)
P74548 6.44e-30 118 33 4 228 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9CM80 6.86e-30 118 31 5 235 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pasteurella multocida (strain Pm70)
Q5E5I1 7.31e-30 115 35 6 244 3 hmuV Hemin import ATP-binding protein HmuV Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q63NR0 7.34e-30 116 32 5 271 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia pseudomallei (strain K96243)
Q3JHM1 7.34e-30 116 32 5 271 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia pseudomallei (strain 1710b)
Q62A98 7.34e-30 116 32 5 271 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia mallei (strain ATCC 23344)
Q65S66 9.99e-30 117 31 5 229 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q1LC89 1.18e-29 115 31 4 257 3 hmuV Hemin import ATP-binding protein HmuV Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q138A9 1.25e-29 115 33 5 240 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB5)
Q7N3S7 1.35e-29 115 33 7 251 3 hmuV Hemin import ATP-binding protein HmuV Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8DPC2 1.48e-29 117 36 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q42 1.48e-29 117 36 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JW0 1.48e-29 117 36 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q9JUX4 1.57e-29 117 34 7 250 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
E0SCY1 1.69e-29 118 36 3 202 1 ousV Glycine betaine/choline transport system ATP-binding protein OusV Dickeya dadantii (strain 3937)
Q6LR20 1.78e-29 117 33 7 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Photobacterium profundum (strain SS9)
Q8RQL7 1.83e-29 114 33 4 211 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q9G4F5 1.87e-29 117 31 5 256 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q9JZW0 2.21e-29 117 34 7 250 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q92WJ0 2.29e-29 117 36 5 210 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhizobium meliloti (strain 1021)
Q1I4Q5 2.68e-29 114 37 5 226 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas entomophila (strain L48)
Q92N13 3.63e-29 114 31 6 238 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium meliloti (strain 1021)
P48243 6.6e-29 113 33 4 211 1 gluA Glutamate transport ATP-binding protein GluA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
O05732 6.83e-29 113 34 3 236 3 HP_0888 Probable iron chelatin transport ATP-binding protein HP_0888 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZKW3 6.9e-29 113 34 3 236 3 jhp_0821 Probable iron chelatin transport ATP-binding protein jhp_0821 Helicobacter pylori (strain J99 / ATCC 700824)
P56344 7.31e-29 112 34 5 221 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q5YZY9 7.57e-29 115 34 5 226 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nocardia farcinica (strain IFM 10152)
Q668K6 7.7e-29 115 30 5 250 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q93DX8 7.9e-29 113 33 5 241 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q70YG7 8.84e-29 113 29 7 274 1 hmuV Hemin import ATP-binding protein HmuV Vibrio anguillarum (strain ATCC 68554 / 775)
Q8D0W8 1.15e-28 115 30 5 250 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pestis
Q9TKX3 1.17e-28 114 33 6 266 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nephroselmis olivacea
Q65UE1 1.22e-28 115 29 4 246 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7NX01 1.31e-28 115 32 5 240 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0B697 2.02e-28 112 30 5 272 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q7W9U5 2.09e-28 114 35 4 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q6F0V4 2.51e-28 114 31 6 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q6G475 2.62e-28 112 29 7 250 3 hmuV Hemin import ATP-binding protein HmuV Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A3CMQ7 2.86e-28 114 35 4 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus sanguinis (strain SK36)
P17328 3.36e-28 114 31 6 235 2 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57243 3.58e-28 111 31 6 246 3 HI_1272 Uncharacterized ABC transporter ATP-binding protein HI_1272 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8PC11 3.6e-28 113 31 5 252 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q7WGW1 3.73e-28 113 35 4 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q4K5Z7 4.11e-28 111 33 8 257 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q7VZE5 4.13e-28 113 35 4 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P14175 4.52e-28 114 31 6 235 1 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Escherichia coli (strain K12)
Q3K6R9 5.75e-28 110 35 5 228 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain Pf0-1)
O34631 9.02e-28 114 32 5 255 3 yvrA Uncharacterized ABC transporter ATP-binding protein YvrA Bacillus subtilis (strain 168)
Q1GB17 9.21e-28 112 35 6 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q03JH1 9.31e-28 113 34 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M397 9.5e-28 113 34 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
P9WQM1 1e-27 112 35 5 237 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQM0 1e-27 112 35 5 237 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4W3 1e-27 112 35 5 237 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q5LYN4 1.01e-27 112 34 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain CNRZ 1066)
O84071 1.14e-27 110 32 6 217 3 CT_068 Probable metal transport system ATP-binding protein CT_068 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KCC5 1.35e-27 112 31 5 224 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain Pf0-1)
Q8D653 1.62e-27 111 32 6 246 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio vulnificus (strain CMCP6)
Q70GD4 1.76e-27 110 31 6 231 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damsela subsp. piscicida
Q659V4 2.12e-27 109 31 6 231 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damselae subsp. damselae
Q6MIP7 2.56e-27 109 32 8 246 3 phnC Phosphonates import ATP-binding protein PhnC Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q04BG2 2.65e-27 111 35 6 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q93SH7 2.67e-27 109 28 6 257 3 hmuV Hemin import ATP-binding protein HmuV Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q74K65 2.94e-27 111 33 8 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q0K1N8 3.3e-27 109 30 6 244 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q9CP06 3.36e-27 111 30 4 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
Q8PNN4 4.77e-27 110 30 5 258 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas axonopodis pv. citri (strain 306)
Q9RZU5 5.38e-27 108 32 6 245 3 hmuV Hemin import ATP-binding protein HmuV Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q2JLH7 5.38e-27 108 31 7 244 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q87DT9 5.72e-27 110 34 5 240 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q2RZ08 6.02e-27 108 31 6 238 3 hmuV Hemin import ATP-binding protein HmuV Salinibacter ruber (strain DSM 13855 / M31)
Q2K8C8 6.31e-27 110 35 4 202 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
O68877 6.68e-27 108 35 6 239 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02FW7 6.68e-27 108 35 6 239 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas aeruginosa (strain UCBPP-PA14)
Q52666 6.98e-27 108 29 4 227 3 bztD Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q04G50 7e-27 110 31 4 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q0I3Y9 7.36e-27 110 29 4 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
Q16BC5 9.55e-27 107 29 8 245 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q578K3 1.01e-26 109 36 5 204 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus biovar 1 (strain 9-941)
Q2YKX3 1.01e-26 109 36 5 204 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus (strain 2308)
P45171 1.16e-26 109 29 4 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5L222 1.19e-26 109 32 6 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
Q8DUF7 1.22e-26 110 34 4 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8Z0H0 1.24e-26 109 31 5 238 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q6D2F6 1.3e-26 109 31 7 238 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q88ZJ6 1.48e-26 109 32 6 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q1H0W2 1.54e-26 107 28 4 239 3 hmuV Hemin import ATP-binding protein HmuV Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q84EY8 1.73e-26 107 34 6 230 3 hmuV Hemin import ATP-binding protein HmuV Enterobacter cloacae
Q8Z4V6 1.88e-26 109 28 5 254 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhi
Q9PDN2 1.92e-26 108 35 4 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
P40860 1.95e-26 109 28 5 254 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q73P71 2e-26 107 26 5 233 3 phnC Phosphonates import ATP-binding protein PhnC Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q6MCV4 2.03e-26 109 33 5 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Protochlamydia amoebophila (strain UWE25)
P10346 2.04e-26 106 31 4 208 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
Q83MG3 2.06e-26 106 33 5 213 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella flexneri
Q4QK57 2.15e-26 109 29 4 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q31J97 2.18e-26 107 31 4 228 3 hmuV Hemin import ATP-binding protein HmuV Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q0SML1 2.2e-26 108 30 5 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
Q8REG7 2.36e-26 106 29 6 243 3 phnC Phosphonates import ATP-binding protein PhnC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
P74981 2.52e-26 107 33 6 245 1 hmuV Hemin import ATP-binding protein HmuV Yersinia enterocolitica
Q9HQ18 2.74e-26 109 27 3 236 1 btuD Cobalamin import ATP-binding protein BtuD Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G4 2.74e-26 109 27 3 236 3 btuD Cobalamin import ATP-binding protein BtuD Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q8DZJ0 2.9e-26 108 34 4 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E554 2.9e-26 108 34 4 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype III (strain NEM316)
Q3K0Y6 2.9e-26 108 34 4 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q73XU8 3.05e-26 108 34 5 238 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q1QE80 3.08e-26 109 33 5 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q73GK9 3.36e-26 105 27 7 239 3 znuC Zinc import ATP-binding protein ZnuC Wolbachia pipientis wMel
Q6G098 3.41e-26 106 30 6 242 3 hmuV Hemin import ATP-binding protein HmuV Bartonella quintana (strain Toulouse)
Q38VW6 3.46e-26 108 31 11 274 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
Q7CN92 3.82e-26 108 33 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q99ZS8 3.82e-26 108 33 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M1
Q58283 3.92e-26 107 29 6 241 3 MJ0873 Uncharacterized ABC transporter ATP-binding protein MJ0873 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q5FL41 4.02e-26 108 32 5 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q8UCM5 4.67e-26 105 28 6 246 3 hmuV Hemin import ATP-binding protein HmuV Agrobacterium fabrum (strain C58 / ATCC 33970)
O85818 4.75e-26 108 29 4 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
Q9KL34 4.77e-26 105 28 5 258 3 hmuV Hemin import ATP-binding protein HmuV Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KS33 5.79e-26 108 30 4 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q98G42 5.88e-26 107 28 4 226 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q46TK4 6.02e-26 106 29 6 244 3 phnC Phosphonates import ATP-binding protein PhnC Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A1B9H9 6.14e-26 105 34 5 216 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Paracoccus denitrificans (strain Pd 1222)
P39456 6.17e-26 105 30 5 233 1 tcyC L-cystine import ATP-binding protein TcyC Bacillus subtilis (strain 168)
Q8XDV7 6.38e-26 105 32 5 218 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O157:H7
P16676 6.42e-26 107 28 5 250 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
Q65T42 6.78e-26 107 31 5 228 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8FFB3 7.04e-26 107 28 5 250 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XBJ8 7.18e-26 107 28 5 250 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
Q1J6Q6 7.45e-26 107 33 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGY7 7.45e-26 107 33 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JLT7 7.45e-26 107 33 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBV6 7.45e-26 107 33 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q5X627 7.68e-26 107 31 5 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q3SGJ8 7.86e-26 105 31 6 248 3 phnC Phosphonates import ATP-binding protein PhnC Thiobacillus denitrificans (strain ATCC 25259)
Q9PKX1 8.29e-26 105 31 6 217 3 TC_0339 Probable metal transport system ATP-binding protein TC_0339 Chlamydia muridarum (strain MoPn / Nigg)
P33982 8.57e-26 105 31 6 238 3 AZC_3926 Probable ABC transporter ATP-binding protein AZC_3926 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q88ZZ2 9.28e-26 109 29 3 229 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88ZZ2 9.28e-16 80 28 8 248 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q329I3 1.03e-25 105 32 6 243 3 phnC Phosphonates import ATP-binding protein PhnC Shigella dysenteriae serotype 1 (strain Sd197)
Q042G7 1.12e-25 107 33 8 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q8NQU4 1.13e-25 104 30 4 226 1 argV Arginine transport ATP-binding protein ArgV Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8U6M1 1.22e-25 106 35 5 203 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Agrobacterium fabrum (strain C58 / ATCC 33970)
P0CZ35 1.29e-25 107 33 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TP4 1.29e-25 107 33 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M28 (strain MGAS6180)
P0CZ34 1.29e-25 107 33 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q7UC29 1.34e-25 107 28 5 250 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
Q9A7X1 1.35e-25 106 35 4 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q5XCA4 1.41e-25 107 33 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q32EY4 1.7e-25 106 30 5 249 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella dysenteriae serotype 1 (strain Sd197)
Q7NIW1 1.83e-25 106 31 4 247 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q1DCP5 1.94e-25 104 31 8 251 3 hmuV Hemin import ATP-binding protein HmuV Myxococcus xanthus (strain DK1622)
Q9I6L0 2.23e-25 105 30 5 240 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O51587 2.27e-25 105 29 5 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q1RD28 2.55e-25 106 30 5 249 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain UTI89 / UPEC)
A1AA20 2.55e-25 106 30 5 249 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O1:K1 / APEC
Q7WEH6 2.6e-25 103 34 3 246 3 hmuV Hemin import ATP-binding protein HmuV Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P69877 2.61e-25 106 30 5 249 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri
P69874 2.61e-25 106 30 5 249 1 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain K12)
P69875 2.61e-25 106 30 5 249 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIU8 2.61e-25 106 30 5 249 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P69876 2.61e-25 106 30 5 249 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O157:H7
Q8ELR4 2.63e-25 106 30 4 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8FVV5 2.63e-25 105 36 5 204 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella suis biovar 1 (strain 1330)
Q6F0P3 2.69e-25 103 26 7 249 3 phnC Phosphonates import ATP-binding protein PhnC Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q7MFA1 2.77e-25 103 28 4 237 3 hmuV Hemin import ATP-binding protein HmuV Vibrio vulnificus (strain YJ016)
A1VZQ5 2.88e-25 103 28 3 225 3 peb1C Probable ABC transporter ATP-binding protein PEB1C Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q7VNG4 2.92e-25 106 28 4 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q92UV5 2.92e-25 106 31 3 214 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhizobium meliloti (strain 1021)
P14788 3.04e-25 105 31 6 238 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q2K4V4 3.05e-25 105 29 4 222 3 ugpC2 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8D3S8 3.08e-25 103 28 4 237 3 hmuV Hemin import ATP-binding protein HmuV Vibrio vulnificus (strain CMCP6)
Q4JTG9 3.14e-25 105 31 4 217 3 metN Methionine import ATP-binding protein MetN Corynebacterium jeikeium (strain K411)
Q6D201 3.14e-25 105 29 4 239 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q57SD6 3.24e-25 105 33 7 250 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella choleraesuis (strain SC-B67)
Q8PP41 3.25e-25 103 35 5 213 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Xanthomonas axonopodis pv. citri (strain 306)
Q52815 3.35e-25 103 28 4 234 3 aapP General L-amino acid transport ATP-binding protein AapP Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q5ZWE4 3.5e-25 105 30 5 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q2SSS4 3.65e-25 105 31 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q0T5R2 3.99e-25 105 31 5 226 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri serotype 5b (strain 8401)
A8AHA1 4.21e-25 103 33 4 224 3 btuD Vitamin B12 import ATP-binding protein BtuD Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q0P9X7 4.29e-25 103 28 3 225 3 peb1C Probable ABC transporter ATP-binding protein PEB1C Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q11ID5 4.34e-25 103 30 5 239 3 hmuV Hemin import ATP-binding protein HmuV Chelativorans sp. (strain BNC1)
Q0T9T7 4.42e-25 103 32 5 218 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q660M8 4.73e-25 105 29 5 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q1GJU0 4.86e-25 103 32 4 234 3 hmuV Hemin import ATP-binding protein HmuV Ruegeria sp. (strain TM1040)
C3LLU1 4.88e-25 103 31 5 232 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio cholerae serotype O1 (strain M66-2)
Q9KSL1 4.88e-25 103 31 5 232 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7MMN0 5.92e-25 103 30 6 237 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain YJ016)
Q8DFQ4 5.92e-25 103 30 6 237 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain CMCP6)
P46920 5.93e-25 105 35 6 205 1 opuAA Glycine betaine transport ATP-binding protein OpuAA Bacillus subtilis (strain 168)
Q6MU19 5.96e-25 104 30 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
P54954 6.07e-25 102 29 8 234 1 yxeO Probable amino-acid import ATP-binding protein YxeO Bacillus subtilis (strain 168)
P27675 6.18e-25 102 29 4 220 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
O34392 6.25e-25 102 32 3 179 2 ytrE ABC transporter ATP-binding protein YtrE Bacillus subtilis (strain 168)
Q87PH3 6.8e-25 105 31 8 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q89UD2 7.1e-25 104 32 4 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q58664 7.13e-25 102 29 6 233 3 livF Probable branched-chain amino acid transport ATP-binding protein LivF Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q5PFQ7 7.22e-25 105 32 7 250 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z8W8 7.83e-25 104 32 7 250 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhi
Q82WT5 8.32e-25 104 31 4 232 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q30W28 9.02e-25 102 32 5 218 3 phnC Phosphonates import ATP-binding protein PhnC Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
P96063 9.03e-25 104 32 7 250 2 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q326G9 9.31e-25 102 32 5 213 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella boydii serotype 4 (strain Sb227)
Q85A69 9.96e-25 104 35 3 189 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Anthoceros angustus
Q8YCG3 1.03e-24 104 36 5 204 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q14Q07 1.05e-24 104 30 5 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Spiroplasma citri
Q3Z2Z3 1.05e-24 104 30 5 249 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella sonnei (strain Ss046)
Q31ZK0 1.05e-24 104 30 5 249 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella boydii serotype 4 (strain Sb227)
Q5WXF0 1.07e-24 104 30 5 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q0T8D1 1.09e-24 101 32 5 213 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella flexneri serotype 5b (strain 8401)
Q3YUN6 1.14e-24 102 32 4 209 3 phnC Phosphonates import ATP-binding protein PhnC Shigella sonnei (strain Ss046)
P63351 1.16e-24 102 35 4 217 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63352 1.16e-24 102 35 4 217 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella typhi
B4TGI0 1.16e-24 102 35 4 217 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella heidelberg (strain SL476)
B5FJ99 1.16e-24 102 35 4 217 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella dublin (strain CT_02021853)
Q57PU4 1.16e-24 102 35 4 217 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella choleraesuis (strain SC-B67)
B5QVV9 1.18e-24 102 35 4 217 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella enteritidis PT4 (strain P125109)
B5BA33 1.25e-24 102 34 5 235 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella paratyphi A (strain AKU_12601)
Q5PH81 1.25e-24 102 34 5 235 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q6N7Y6 1.32e-24 102 31 6 243 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P31134 1.51e-24 104 33 8 230 1 potG Putrescine transport ATP-binding protein PotG Escherichia coli (strain K12)
Q1MCN6 1.53e-24 103 29 4 222 3 ugpC1 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1R3F6 1.59e-24 102 33 5 215 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain UTI89 / UPEC)
Q7W025 1.66e-24 102 33 3 246 3 hmuV Hemin import ATP-binding protein HmuV Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q72AQ6 1.72e-24 102 29 7 246 3 phnC Phosphonates import ATP-binding protein PhnC Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q32K28 1.74e-24 101 32 5 213 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella dysenteriae serotype 1 (strain Sd197)
Q81XB3 1.76e-24 101 30 3 236 1 fatE Petrobactin import ATP-binding protein FatE Bacillus anthracis
Q8FAV1 1.76e-24 102 33 5 215 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8EPK1 1.77e-24 103 30 8 242 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q3A9G5 1.89e-24 103 30 8 245 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q7MKU3 1.92e-24 103 30 7 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain YJ016)
Q8D9J4 1.92e-24 103 30 7 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain CMCP6)
Q87RE5 2.04e-24 101 30 5 227 3 znuC Zinc import ATP-binding protein ZnuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q4FL37 2.09e-24 103 33 3 190 1 tmoW Trimethylamine N-oxide transport system ATP-binding protein TmoW Pelagibacter ubique (strain HTCC1062)
A1WXT0 2.17e-24 101 29 4 234 3 znuC Zinc import ATP-binding protein ZnuC Halorhodospira halophila (strain DSM 244 / SL1)
Q10V16 2.29e-24 101 29 6 223 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Trichodesmium erythraeum (strain IMS101)
Q1BG75 2.33e-24 101 36 6 199 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia orbicola (strain AU 1054)
A0KE71 2.33e-24 101 36 6 199 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia cenocepacia (strain HI2424)
P44513 2.49e-24 103 29 5 245 1 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7NWX3 2.54e-24 103 34 3 201 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
O28881 2.68e-24 101 27 8 247 3 livG Probable branched-chain amino acid transport ATP-binding protein LivG Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9X196 2.91e-24 103 31 4 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9MUN1 3.26e-24 102 30 4 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q9I2N4 3.43e-24 103 33 6 222 3 modC Molybdenum import ATP-binding protein ModC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q31TP8 3.46e-24 101 32 5 218 3 phnC Phosphonates import ATP-binding protein PhnC Shigella boydii serotype 4 (strain Sb227)
Q92AF9 3.87e-24 100 29 9 243 3 mntB Manganese transport system ATP-binding protein MntB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q7W359 3.92e-24 100 33 3 246 3 hmuV Hemin import ATP-binding protein HmuV Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q07PZ0 3.97e-24 101 31 6 241 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisA53)
Q5YRK2 4.08e-24 100 32 7 224 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Nocardia farcinica (strain IFM 10152)
Q4KC87 4.16e-24 102 33 6 209 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q24QI5 4.55e-24 102 30 7 239 3 metN Methionine import ATP-binding protein MetN Desulfitobacterium hafniense (strain Y51)
Q89C51 4.73e-24 100 30 6 233 3 phnC Phosphonates import ATP-binding protein PhnC Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q2K551 4.81e-24 100 28 3 235 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8EBC3 5.6e-24 102 32 6 235 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q48J29 5.82e-24 102 33 4 213 3 modC Molybdenum import ATP-binding protein ModC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q830W6 6.23e-24 102 32 5 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q9AE30 7.51e-24 100 28 4 252 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium leguminosarum
Q88AS5 7.72e-24 101 30 5 240 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A0A0H2ZLL3 7.94e-24 99 27 5 238 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q4ZSS5 8.13e-24 102 33 5 218 3 modC Molybdenum import ATP-binding protein ModC Pseudomonas syringae pv. syringae (strain B728a)
Q03EE4 8.33e-24 100 28 6 247 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q1LQB5 9.24e-24 100 28 7 270 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q609Q1 9.36e-24 101 36 4 199 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9RKQ4 9.53e-24 100 34 7 240 3 hmuV Hemin import ATP-binding protein HmuV Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8DIA0 1e-23 101 31 4 228 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B7VPD0 1.01e-23 99 31 4 219 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio atlanticus (strain LGP32)
Q6D4E2 1.06e-23 102 31 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1TAI4 1.14e-23 101 33 7 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q8NR42 1.15e-23 99 31 6 217 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8UA73 1.16e-23 101 33 2 196 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q5E586 1.3e-23 101 29 6 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q6NBT1 1.31e-23 101 33 5 240 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q9KFL0 1.59e-23 99 27 7 234 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q3M5J9 1.6e-23 99 33 8 221 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P55662 1.65e-23 99 29 5 232 3 NGR_a01510 Probable amino-acid ABC transporter ATP-binding protein y4tH Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P40790 1.66e-23 101 30 5 243 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57QC8 1.66e-23 101 30 5 243 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella choleraesuis (strain SC-B67)
Q2J3T0 1.69e-23 99 28 4 232 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain HaA2)
Q1MCZ1 1.7e-23 99 28 3 238 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q98GF5 1.75e-23 99 27 6 261 3 phnC Phosphonates import ATP-binding protein PhnC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P16677 1.78e-23 99 32 5 218 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain K12)
Q48CA0 1.85e-23 99 31 7 219 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q5PMK1 1.9e-23 101 30 5 243 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z7H7 1.94e-23 101 30 5 243 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhi
Q4ZQE3 1.99e-23 99 32 9 225 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas syringae pv. syringae (strain B728a)
A1TXH7 2.1e-23 100 31 5 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q8RLB6 2.11e-23 98 32 6 227 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Delftia acidovorans
Q032D0 2.13e-23 98 28 6 247 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. cremoris (strain SK11)
O34338 2.26e-23 98 28 7 240 2 mntB Manganese transport system ATP-binding protein MntB Bacillus subtilis (strain 168)
Q8UCD5 2.45e-23 100 30 3 217 3 modC Molybdenum import ATP-binding protein ModC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q132E8 2.57e-23 99 31 8 244 3 phnC Phosphonates import ATP-binding protein PhnC Rhodopseudomonas palustris (strain BisB5)
Q881C1 2.6e-23 100 34 4 213 3 modC Molybdenum import ATP-binding protein ModC Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9RR46 2.65e-23 100 34 7 205 1 gbuA Glycine betaine/carnitine transport ATP-binding protein GbuA Listeria monocytogenes serotype 1/2a (strain 10403S)
Q6LQC0 2.81e-23 99 30 5 227 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium profundum (strain SS9)
A5F1V0 2.9e-23 98 30 5 232 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q0BUR6 2.97e-23 98 34 5 201 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q9AB70 2.97e-23 98 27 7 254 3 phnC Phosphonates import ATP-binding protein PhnC Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q5WIL7 3.64e-23 98 29 8 247 3 phnC Phosphonates import ATP-binding protein PhnC Shouchella clausii (strain KSM-K16)
P42360 3.83e-23 98 28 8 247 1 scaC Manganese import ATP-binding protein ScaC Streptococcus gordonii
Q88CL2 3.91e-23 99 31 5 251 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2SJY7 4.03e-23 100 32 6 204 3 potA Spermidine/putrescine import ATP-binding protein PotA Hahella chejuensis (strain KCTC 2396)
P0AAF9 4.06e-23 97 29 6 237 3 artP Arginine transport ATP-binding protein ArtP Shigella flexneri
P0AAF6 4.06e-23 97 29 6 237 1 artP Arginine transport ATP-binding protein ArtP Escherichia coli (strain K12)
P0AAF7 4.06e-23 97 29 6 237 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAF8 4.06e-23 97 29 6 237 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O157:H7
Q0ASQ1 4.22e-23 98 29 6 247 3 phnC Phosphonates import ATP-binding protein PhnC Maricaulis maris (strain MCS10)
Q1J255 4.46e-23 98 31 5 244 3 hmuV Hemin import ATP-binding protein HmuV Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q65M34 4.59e-23 99 30 6 234 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q83P97 4.6e-23 98 30 6 242 3 phnC Phosphonates import ATP-binding protein PhnC Shigella flexneri
Q0SXV5 4.6e-23 98 30 6 242 3 phnC Phosphonates import ATP-binding protein PhnC Shigella flexneri serotype 5b (strain 8401)
Q8XZQ4 4.6e-23 98 32 7 221 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q50966 4.83e-23 99 30 5 223 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae
Q722B1 5.04e-23 99 31 5 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serotype 4b (strain F2365)
Q83CV2 5.15e-23 97 30 4 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q6LQ77 5.38e-23 97 29 3 226 3 btuD Vitamin B12 import ATP-binding protein BtuD Photobacterium profundum (strain SS9)
Q9K876 5.42e-23 99 30 5 240 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q3Z5U5 6.02e-23 97 31 5 213 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella sonnei (strain Ss046)
Q3J7S3 6.02e-23 97 30 6 223 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q18KE1 6.18e-23 98 32 6 215 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q6D4A8 6.3e-23 97 32 8 235 3 znuC Zinc import ATP-binding protein ZnuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q13ZK7 6.31e-23 99 31 9 256 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Paraburkholderia xenovorans (strain LB400)
Q5WBL0 6.32e-23 97 29 7 225 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Shouchella clausii (strain KSM-K16)
Q98DT6 6.99e-23 97 34 6 200 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q21GS5 7.19e-23 99 33 5 211 3 modC Molybdenum import ATP-binding protein ModC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q21BU8 7.46e-23 99 26 7 267 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB18)
Q0S0X2 7.47e-23 97 33 6 209 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Rhodococcus jostii (strain RHA1)
Q3SQ65 7.61e-23 97 30 4 228 3 hmuV Hemin import ATP-binding protein HmuV Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
D4GP39 7.68e-23 99 35 2 193 1 xacK Xylose/arabinose import ATP-binding protein XacK Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q97KS6 7.77e-23 99 30 4 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A0AGP9 7.92e-23 99 31 5 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q92DL6 8e-23 99 32 6 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q92VJ2 8.6e-23 99 29 4 240 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q9KQB8 8.64e-23 97 27 5 237 3 znuC Zinc import ATP-binding protein ZnuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5X2Z8 9.01e-23 96 31 5 216 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila (strain Paris)
Q89AJ0 9.22e-23 96 27 6 237 3 znuC Zinc import ATP-binding protein ZnuC Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P63354 9.37e-23 99 32 5 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella suis biovar 1 (strain 1330)
P63353 9.37e-23 99 32 5 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q4ZLS1 9.72e-23 97 31 7 219 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. syringae (strain B728a)
Q3K506 9.87e-23 97 30 5 219 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas fluorescens (strain Pf0-1)
Q8XIZ5 1e-22 99 28 4 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain 13 / Type A)
Q0TNZ3 1e-22 99 28 4 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q03ZQ0 1.04e-22 99 32 4 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q217B2 1.05e-22 97 31 7 254 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB18)
Q5FA19 1.11e-22 98 30 4 223 1 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q28VL7 1.11e-22 96 33 3 189 3 thiQ Thiamine import ATP-binding protein ThiQ Jannaschia sp. (strain CCS1)
A0L0V9 1.14e-22 100 33 7 218 3 macB Macrolide export ATP-binding/permease protein MacB Shewanella sp. (strain ANA-3)
Q1CJG3 1.22e-22 96 31 7 229 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CIC2 1.22e-22 96 31 7 229 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis
Q1C812 1.22e-22 96 31 7 229 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Antiqua)
Q8RI39 1.24e-22 99 28 5 254 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8TYV9 1.32e-22 97 32 2 198 3 MK0182 Putative ABC transporter ATP-binding protein MK0182 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q87AL9 1.37e-22 98 32 5 222 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q6D654 1.39e-22 96 35 6 222 3 btuD Vitamin B12 import ATP-binding protein BtuD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q668Q3 1.44e-22 98 30 6 226 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CJS9 1.53e-22 98 30 6 226 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZCM2 1.53e-22 98 30 6 226 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis
Q1C607 1.53e-22 98 30 6 226 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis bv. Antiqua (strain Antiqua)
Q9CIQ6 1.54e-22 96 28 6 243 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. lactis (strain IL1403)
Q5HQ70 1.55e-22 98 31 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8XA06 1.55e-22 95 32 5 213 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O157:H7
Q31I88 1.55e-22 97 29 9 244 3 pstB Phosphate import ATP-binding protein PstB Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q49XC6 1.57e-22 96 28 5 226 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8A883 1.61e-22 99 28 4 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q24XJ2 1.66e-22 98 29 4 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Desulfitobacterium hafniense (strain Y51)
P31548 1.72e-22 95 32 5 213 1 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli (strain K12)
Q7N8V0 1.72e-22 95 31 5 232 3 thiQ Thiamine import ATP-binding protein ThiQ Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q39LW7 1.74e-22 96 34 5 215 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q897I2 1.74e-22 99 31 8 220 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q897I2 4.1e-07 54 23 1 121 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q66AT7 1.77e-22 96 30 7 229 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1M7A6 1.78e-22 96 30 4 222 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2JB14 1.79e-22 96 32 5 214 3 phnC Phosphonates import ATP-binding protein PhnC Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q9V2C0 1.79e-22 98 29 4 216 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus abyssi (strain GE5 / Orsay)
Q4L8L7 1.82e-22 95 28 7 222 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus haemolyticus (strain JCSC1435)
Q1WVI7 1.89e-22 98 29 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
Q0SRL2 1.89e-22 98 28 4 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain SM101 / Type A)
Q18AM3 1.98e-22 97 27 4 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridioides difficile (strain 630)
Q49WM4 2.11e-22 98 28 4 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q321G6 2.14e-22 95 31 4 217 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella boydii serotype 4 (strain Sb227)
O32151 2.14e-22 98 29 4 221 3 yurJ Uncharacterized ABC transporter ATP-binding protein YurJ Bacillus subtilis (strain 168)
Q8RGC8 2.2e-22 98 31 4 222 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q87UI3 2.26e-22 96 31 7 219 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8DQY5 2.27e-22 99 27 2 226 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8DQY5 4.68e-12 69 28 6 221 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q11D92 2.33e-22 95 30 4 218 3 thiQ Thiamine import ATP-binding protein ThiQ Chelativorans sp. (strain BNC1)
Q5PIA5 2.39e-22 95 30 7 236 3 znuC Zinc import ATP-binding protein ZnuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57NA5 2.39e-22 95 30 7 236 3 znuC Zinc import ATP-binding protein ZnuC Salmonella choleraesuis (strain SC-B67)
Q5WUF8 2.42e-22 95 31 5 216 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila (strain Lens)
Q57TF5 2.42e-22 95 32 5 215 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella choleraesuis (strain SC-B67)
Q9I6T2 2.45e-22 98 32 3 204 3 potA1 Spermidine/putrescine import ATP-binding protein PotA 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZCC4 2.55e-22 95 29 5 202 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia prowazekii (strain Madrid E)
P54537 2.57e-22 95 27 5 230 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q9K8N1 2.57e-22 95 28 7 256 3 phnC3 Phosphonates import ATP-binding protein PhnC 3 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q92XW1 2.57e-22 97 32 4 217 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Rhizobium meliloti (strain 1021)
Q4QP85 2.6e-22 97 29 5 234 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Haemophilus influenzae (strain 86-028NP)
Q60AI1 2.65e-22 98 35 7 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q01937 2.74e-22 97 32 5 220 3 lacK Lactose transport ATP-binding protein LacK Rhizobium radiobacter
Q2IYS5 2.84e-22 96 31 4 217 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain HaA2)
Q7M816 2.84e-22 96 32 4 207 3 metN Methionine import ATP-binding protein MetN Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q8UH62 2.87e-22 97 32 6 238 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q6WB63 3.06e-22 96 30 6 226 3 phnC Phosphonates import ATP-binding protein PhnC Alcaligenes faecalis
Q3Z2L6 3.07e-22 95 30 7 238 3 znuC Zinc import ATP-binding protein ZnuC Shigella sonnei (strain Ss046)
Q322E8 3.07e-22 95 30 7 238 3 znuC Zinc import ATP-binding protein ZnuC Shigella boydii serotype 4 (strain Sb227)
Q1RAS6 3.07e-22 95 30 7 238 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain UTI89 / UPEC)
P0A9X1 3.07e-22 95 30 7 238 1 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain K12)
P0A9X2 3.07e-22 95 30 7 238 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGX4 3.07e-22 95 30 7 238 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AC19 3.07e-22 95 30 7 238 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O1:K1 / APEC
P0A9X3 3.07e-22 95 30 7 238 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O157:H7
Q7MPC5 3.07e-22 95 34 4 200 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio vulnificus (strain YJ016)
Q8DE95 3.07e-22 95 34 4 200 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio vulnificus (strain CMCP6)
Q8Y8T6 3.23e-22 97 30 5 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P55453 3.24e-22 97 31 4 222 3 NGR_a03670 Uncharacterized ABC transporter ATP-binding protein y4fO Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8Y651 3.33e-22 95 28 9 243 3 mntB Manganese transport system ATP-binding protein MntB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q3KBH4 3.58e-22 97 33 3 192 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas fluorescens (strain Pf0-1)
Q1B8V9 3.69e-22 97 32 7 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain MCS)
A1UG51 3.69e-22 97 32 7 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain KMS)
Q9PF03 3.75e-22 97 32 5 221 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain 9a5c)
Q8ZNV7 3.81e-22 95 30 7 236 2 znuC Zinc import ATP-binding protein ZnuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q81CT8 4e-22 99 30 7 223 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CT8 3.58e-13 72 26 4 236 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q82MV1 4.03e-22 95 31 6 221 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q03PF2 4.38e-22 97 31 5 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q5PDF8 4.42e-22 94 32 5 215 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8EIL8 4.49e-22 99 33 7 218 3 macB Macrolide export ATP-binding/permease protein MacB Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q32HA3 4.49e-22 95 30 7 238 3 znuC Zinc import ATP-binding protein ZnuC Shigella dysenteriae serotype 1 (strain Sd197)
Q1GIE5 4.65e-22 97 33 5 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria sp. (strain TM1040)
Q9KUI0 4.72e-22 97 35 4 194 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q4W575 4.77e-22 97 30 4 223 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JVH1 4.77e-22 97 30 4 223 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q8Z5W6 4.78e-22 95 30 7 238 3 znuC Zinc import ATP-binding protein ZnuC Salmonella typhi
Q8Z9I6 4.9e-22 94 32 5 215 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella typhi
Q8FL82 4.9e-22 94 31 5 213 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q6RCE0 4.91e-22 95 28 6 251 3 phnC Phosphonates import ATP-binding protein PhnC Stutzerimonas stutzeri
Q0TLS2 5e-22 94 31 5 213 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1RGD0 5.16e-22 94 31 5 213 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli (strain UTI89 / UPEC)
Q1CDR0 5.35e-22 95 33 6 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Nepal516)
Q74PI5 5.35e-22 95 33 6 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis
Q1C1S0 5.35e-22 95 33 6 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Antiqua)
Q9EYM2 5.78e-22 94 30 5 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_14825
Feature type CDS
Gene fepC
Product ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
Location 24476 - 25294 (strand: 1)
Length 819 (nucleotides) / 272 (amino acids)

Contig

Accession ZDB_694
Length 115897 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1973
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1120 Inorganic ion transport and metabolism (P)
Coenzyme transport and metabolism (H)
PH ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02013 iron complex transport system ATP-binding protein [EC:7.2.2.-] - -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG044281 ABC transporter ATP-binding protein VF1252 Nutritional/Metabolic factor

Protein Sequence

MDLNAMSAQSGLQIKHFNAGYPKRKIIEDLNVEPLPRGKITVLLGPNGSGKSTLLRSLAGLNKAEGQLLLDGHDLTRMNFAERAKQVVYLPQTLPAGVHLHVLESVIVAQRASGGISDRDSEQEVMSLLSQLGIEHLALHYLDQLSGGQKQLVGLAQSLIRQPTLLLLDEPLSALDLNYQYHVMDLVRRETQRRNIITVVVVHDINIALRHGDHILMLKDGNLIAEGDPEAVITPDSLATVYGVRGRIEHCSQSVPHVVIDGLVPRAVAVLA

Flanking regions ( +/- flanking 50bp)

TGTGCCGTTCTTCCTGAGCATGATCCTGCGTCATAAAGGGAGCATGTAAGATGGATTTGAATGCAATGTCTGCTCAGAGCGGGTTACAGATTAAACACTTCAATGCCGGTTATCCGAAACGGAAAATCATTGAAGACCTGAATGTTGAGCCTCTGCCGCGCGGTAAAATCACCGTGCTGCTCGGGCCGAACGGCAGCGGGAAATCGACCCTGCTGCGCTCCCTGGCCGGTCTGAACAAGGCGGAGGGGCAGTTACTGCTCGATGGTCATGATCTGACGCGGATGAATTTTGCCGAACGCGCGAAGCAGGTGGTTTATCTGCCGCAGACACTGCCTGCCGGGGTGCACCTGCATGTGCTGGAATCCGTGATTGTTGCACAGCGGGCTTCAGGCGGTATTTCTGACCGCGACAGTGAGCAGGAAGTGATGTCTCTGCTGTCACAATTAGGCATTGAACATCTGGCGCTGCATTATCTGGATCAGTTATCCGGCGGTCAGAAACAATTAGTCGGGCTGGCGCAATCATTAATCCGTCAGCCGACACTGTTATTACTGGATGAGCCGTTAAGTGCGCTGGATTTAAATTATCAGTATCACGTAATGGATTTGGTACGCCGTGAAACTCAGCGCCGGAATATTATTACGGTGGTGGTTGTGCATGATATTAATATCGCACTGCGTCACGGTGATCATATATTAATGCTGAAAGACGGGAATTTAATTGCGGAAGGGGATCCGGAAGCGGTTATTACGCCGGACAGCCTGGCAACCGTTTATGGTGTGCGCGGCCGTATTGAGCACTGCTCGCAGTCTGTGCCGCATGTTGTTATTGATGGTCTGGTGCCGCGCGCGGTTGCGGTGCTGGCATAATAAAACCGGTTTATATTACATATTCTTTTTTATTCTCTGCGGAATATATT