Homologs in group_2816

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08995 FBDBKF_08995 100.0 Morganella morganii S1 fimA Pilin (type 1 fimbrial protein)
EHELCC_10415 EHELCC_10415 100.0 Morganella morganii S2 fimA Pilin (type 1 fimbrial protein)
NLDBIP_10760 NLDBIP_10760 100.0 Morganella morganii S4 fimA Pilin (type 1 fimbrial protein)
LHKJJB_10595 LHKJJB_10595 100.0 Morganella morganii S3 fimA Pilin (type 1 fimbrial protein)
F4V73_RS10975 F4V73_RS10975 82.0 Morganella psychrotolerans - fimbrial protein

Distribution of the homologs in the orthogroup group_2816

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2816

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P13421 1.26e-40 138 45 2 179 1 smfA Fimbria A protein Serratia marcescens
Q03011 2.03e-34 122 42 4 180 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P42184 1.7e-27 104 41 5 168 1 prsA PRS fimbrial major pilin protein (Fragment) Escherichia coli
P04740 7.94e-26 100 36 4 184 3 KS71A KS71A fimbrillin Escherichia coli
P62607 5.78e-25 98 37 5 185 3 F7-2 F7-2 fimbrial protein Escherichia coli
P62608 5.78e-25 98 37 5 185 3 F7-2 F7-2 fimbrial protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P04127 3.74e-24 96 37 6 193 1 papA Pap fimbrial major pilin protein Escherichia coli
P62605 5.73e-22 90 37 6 186 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 5.73e-22 90 37 6 186 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P37909 3.26e-19 83 33 5 186 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
P12730 7.03e-19 82 34 6 187 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P12903 1.77e-18 81 39 5 159 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
Q47223 2.05e-18 81 37 5 163 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P43660 2.75e-18 80 35 4 178 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P12266 5.62e-17 77 43 4 130 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
Q8X5K5 3.31e-16 75 33 4 178 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P04128 1.35e-15 73 39 4 132 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
Q04681 3.25e-15 72 30 3 187 1 pmfA Major fimbrial subunit Proteus mirabilis (strain HI4320)
P53521 1.79e-13 68 26 4 186 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)
P55223 1.01e-12 66 32 3 156 3 None Fimbrial subunit type 1 Salmonella typhimurium
P37921 8.36e-12 63 31 3 156 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P39264 1.46e-11 63 32 7 184 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P0ABW5 1.91e-11 62 31 4 158 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 1.91e-11 62 31 4 158 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
P37920 5.66e-11 61 33 4 156 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P08189 9.8e-10 58 36 7 177 1 fimF Protein FimF Escherichia coli (strain K12)
P39834 1.35e-09 57 34 5 164 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
P42185 7.39e-09 56 25 5 159 3 prsH PRS fimbrial minor pilin protein Escherichia coli
P07111 4.81e-08 53 25 5 159 1 papH PAP fimbrial minor pilin protein Escherichia coli
P21413 5.15e-08 53 28 7 174 3 fasA Fimbrial protein 987P Escherichia coli
P75855 6.45e-08 53 30 4 157 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
P42191 7.53e-08 53 27 7 162 1 prsK Protein PrsK Escherichia coli
Q8X582 1.14e-07 52 31 4 157 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
P62532 1.19e-07 52 27 7 162 1 papK Fimbrial adapter PapK Escherichia coli
P62533 1.19e-07 52 27 7 162 3 papK Fimbrial adapter PapK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45993 1.7e-06 49 36 2 69 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P37926 3.38e-06 48 27 7 182 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P77288 6.01e-06 47 28 3 184 2 yfcV Uncharacterized fimbrial-like protein YfcV Escherichia coli (strain K12)
P45992 9.64e-06 47 34 2 69 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P42913 1.17e-05 47 25 6 187 2 yraH Uncharacterized fimbrial-like protein YraH Escherichia coli (strain K12)
P77789 1.31e-05 47 27 7 172 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
P38052 1.4e-05 46 24 8 181 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
Q03846 4.26e-05 45 34 2 84 3 hifA Major fimbrial subunit Haemophilus influenzae
P11312 5.42e-05 45 45 2 57 3 F17a-A F17 fimbrial protein Escherichia coli
P13429 6.16e-05 45 26 8 178 1 sfaG S-fimbrial protein subunit SfaG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P45988 6.61e-05 45 34 2 82 3 hifA Major fimbrial subunit Haemophilus influenzae
P45990 6.89e-05 45 33 2 84 3 hifA Major fimbrial subunit Haemophilus influenzae
P22595 0.000153 43 29 8 179 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
P12267 0.000224 43 33 3 93 3 mrkA Fimbrial subunit type 3 Klebsiella pneumoniae
P76499 0.000258 43 28 7 175 2 yfcP Uncharacterized fimbrial-like protein YfcP Escherichia coli (strain K12)
P18103 0.000295 43 26 7 194 3 fanC K99 fimbrial protein Escherichia coli
P45989 0.000395 43 34 2 84 3 hifA Major fimbrial subunit Haemophilus influenzae
P14212 0.000395 43 34 2 84 1 hifA Major fimbrial subunit Haemophilus influenzae

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_13655
Feature type CDS
Gene fimA
Product Pilin (type 1 fimbrial protein)
Location 15793 - 16332 (strand: -1)
Length 540 (nucleotides) / 179 (amino acids)
In genomic island -

Contig

Accession ZDB_692
Length 124746 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2816
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07345 major type 1 subunit fimbrin (pilin) Shigellosis
Pertussis
-

Protein Sequence

MSMKKVVLALAVSSAMAMTAQAANQGGGKINFNGEVIDAACSIDANSLKQTVELGSVAKVQLAKGGKSTPVDFTIQLHNCDITDKTTTTVTFKGVAGGAAADGLDKAFGVSGPATGAMGVVVTDAGGNVIAPGAASSAFTLNEGDNTLNFKAYMQGATTAVTVAPGAFTATADFLMDYQ

Flanking regions ( +/- flanking 50bp)

GCCTTATGTCGGCATTTTTATCTAAAAACGAGCAGATCAGGAATTTTGATATGAGTATGAAAAAAGTGGTTCTCGCACTGGCAGTTTCTTCCGCAATGGCAATGACTGCACAGGCAGCAAATCAGGGCGGCGGCAAAATCAATTTCAACGGTGAAGTGATTGATGCGGCGTGTTCTATCGATGCAAACAGCCTGAAACAGACTGTTGAACTGGGCAGCGTGGCTAAAGTGCAACTGGCGAAGGGCGGTAAATCCACTCCGGTTGATTTCACCATCCAGTTACACAACTGCGATATCACCGATAAAACCACCACAACTGTCACCTTTAAAGGTGTTGCAGGCGGCGCTGCGGCAGACGGCCTGGATAAAGCCTTCGGCGTCAGCGGCCCGGCGACCGGTGCAATGGGTGTGGTAGTGACGGATGCGGGCGGTAATGTGATCGCTCCGGGGGCAGCATCATCCGCATTTACCTTAAACGAAGGTGATAACACGCTGAACTTTAAAGCGTATATGCAGGGTGCCACAACGGCTGTCACCGTTGCGCCGGGTGCTTTCACTGCAACAGCCGACTTCCTGATGGACTATCAGTAATCGGGGTCAGTGTACTTTACCCGTACCGGATATCCGGTACGGGGATCCGG