Homologs in group_2816

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08995 FBDBKF_08995 82.0 Morganella morganii S1 fimA Pilin (type 1 fimbrial protein)
EHELCC_10415 EHELCC_10415 82.0 Morganella morganii S2 fimA Pilin (type 1 fimbrial protein)
NLDBIP_10760 NLDBIP_10760 82.0 Morganella morganii S4 fimA Pilin (type 1 fimbrial protein)
LHKJJB_10595 LHKJJB_10595 82.0 Morganella morganii S3 fimA Pilin (type 1 fimbrial protein)
HKOGLL_13655 HKOGLL_13655 82.0 Morganella morganii S5 fimA Pilin (type 1 fimbrial protein)

Distribution of the homologs in the orthogroup group_2816

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2816

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q03011 2.93e-38 132 44 4 181 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P13421 5.5e-37 129 45 3 180 1 smfA Fimbria A protein Serratia marcescens
P04740 1.08e-25 100 36 6 185 3 KS71A KS71A fimbrillin Escherichia coli
P42184 3.3e-23 93 37 6 169 1 prsA PRS fimbrial major pilin protein (Fragment) Escherichia coli
P04127 4.47e-21 88 36 5 168 1 papA Pap fimbrial major pilin protein Escherichia coli
P62607 5.67e-21 88 35 6 194 3 F7-2 F7-2 fimbrial protein Escherichia coli
P62608 5.67e-21 88 35 6 194 3 F7-2 F7-2 fimbrial protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P62605 1.21e-20 87 39 6 160 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 1.21e-20 87 39 6 160 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P43660 1.28e-18 81 35 7 185 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P04128 3.66e-18 80 42 5 130 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
Q47223 5.59e-18 80 39 7 156 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P12730 5.36e-17 77 34 7 161 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P12903 5.47e-17 77 41 7 153 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P37909 2.67e-16 75 32 5 187 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
P12266 1.25e-15 73 40 5 130 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P39834 4.44e-15 72 35 7 188 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
Q04681 6.39e-15 72 31 4 188 1 pmfA Major fimbrial subunit Proteus mirabilis (strain HI4320)
P53521 1.01e-14 71 28 3 157 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)
Q8X5K5 5.37e-13 67 30 4 180 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P21413 2.13e-12 65 31 9 191 3 fasA Fimbrial protein 987P Escherichia coli
P42191 3.5e-12 64 30 7 163 1 prsK Protein PrsK Escherichia coli
P62532 1.37e-11 63 30 7 163 1 papK Fimbrial adapter PapK Escherichia coli
P62533 1.37e-11 63 30 7 163 3 papK Fimbrial adapter PapK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P55223 2.83e-11 62 30 6 162 3 None Fimbrial subunit type 1 Salmonella typhimurium
P37921 2.55e-10 60 30 6 162 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P39264 1.52e-09 57 28 7 188 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P0ABW5 1.62e-09 57 29 8 163 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 1.62e-09 57 29 8 163 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
P37920 2.19e-09 57 30 6 162 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P42185 1.33e-08 55 24 3 143 3 prsH PRS fimbrial minor pilin protein Escherichia coli
P07111 9.7e-08 53 23 3 143 1 papH PAP fimbrial minor pilin protein Escherichia coli
P75855 2.54e-07 51 29 5 157 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
Q8X582 4.36e-07 50 30 5 157 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
P45993 5.79e-07 50 36 4 90 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P76499 6.78e-07 50 25 7 175 2 yfcP Uncharacterized fimbrial-like protein YfcP Escherichia coli (strain K12)
P45992 1.55e-06 50 34 6 121 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
Q03846 2.5e-06 49 33 3 92 3 hifA Major fimbrial subunit Haemophilus influenzae
P37926 6.58e-06 47 25 7 185 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P38052 6.97e-06 47 24 7 182 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
P14212 3.4e-05 46 34 2 89 1 hifA Major fimbrial subunit Haemophilus influenzae
P45989 3.43e-05 46 34 2 89 3 hifA Major fimbrial subunit Haemophilus influenzae
P77288 5.71e-05 45 28 4 164 2 yfcV Uncharacterized fimbrial-like protein YfcV Escherichia coli (strain K12)
P08189 6.57e-05 45 33 10 181 1 fimF Protein FimF Escherichia coli (strain K12)
P45988 0.000329 43 37 3 77 3 hifA Major fimbrial subunit Haemophilus influenzae
P75860 0.000396 42 27 4 153 2 ycbV Uncharacterized fimbrial-like protein YcbV Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS10975
Feature type CDS
Gene -
Product fimbrial protein
Location 335566 - 336108 (strand: 1)
Length 543 (nucleotides) / 180 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2816
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Protein Sequence

MSMKKILLALAVSSVVAMTAQADNQGSGKVNFKGEIIDAACSIDANSLKQTVELGSVAKVALYKGGKSTPVDFAIQLRNCDITSSSTTTVTFKGIAGDSAEGLDNAFAVSGPATGALGVVVTDAGGKVIAPGLTSSAFTLNNGDNELNFKAYMQGATTASSVGVVPGAFTATADFVMAYQ

Flanking regions ( +/- flanking 50bp)

TATTAAATACGTAAGTATTTTTATCTGAAAAGTAAATCAGGAATGTTGATATGAGTATGAAAAAAATTCTTCTCGCACTGGCGGTTTCTTCTGTTGTGGCAATGACAGCACAGGCGGATAACCAGGGTAGTGGCAAAGTTAATTTTAAGGGTGAAATTATTGATGCGGCATGTTCTATCGATGCGAACAGCCTGAAGCAGACTGTAGAGCTGGGTAGTGTGGCAAAAGTCGCGTTGTACAAAGGCGGCAAATCAACGCCGGTTGATTTCGCTATTCAGTTACGCAACTGTGATATCACAAGCAGTTCTACTACCACAGTGACTTTCAAGGGGATCGCCGGGGATTCAGCTGAAGGGCTGGATAACGCCTTTGCCGTGAGTGGTCCTGCTACCGGTGCACTGGGTGTTGTGGTAACGGATGCGGGCGGTAAGGTTATCGCACCGGGTTTAACATCATCAGCATTTACGTTGAATAACGGTGATAACGAACTGAATTTCAAAGCCTATATGCAGGGCGCGACAACTGCATCTTCTGTTGGTGTTGTTCCGGGTGCATTCACAGCAACAGCTGATTTCGTGATGGCGTATCAGTAATAACGAAATAGTGCTTACCCCGTACCGGTGTTCTGGTACGGGGTTCCGGT