Homologs in group_301

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10460 FBDBKF_10460 100.0 Morganella morganii S1 dmsC DMSO reductase anchor subunit DmsC
EHELCC_14795 EHELCC_14795 100.0 Morganella morganii S2 dmsC DMSO reductase anchor subunit DmsC
NLDBIP_14625 NLDBIP_14625 100.0 Morganella morganii S4 dmsC DMSO reductase anchor subunit DmsC
LHKJJB_14720 LHKJJB_14720 100.0 Morganella morganii S3 dmsC DMSO reductase anchor subunit DmsC
F4V73_RS14160 F4V73_RS14160 88.5 Morganella psychrotolerans - DmsC/YnfH family molybdoenzyme membrane anchor subunit
PMI_RS00815 PMI_RS00815 29.2 Proteus mirabilis HI4320 - dimethyl sulfoxide reductase anchor subunit
PMI_RS08355 PMI_RS08355 33.3 Proteus mirabilis HI4320 - dimethyl sulfoxide reductase anchor subunit

Distribution of the homologs in the orthogroup group_301

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_301

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P18777 1.01e-95 286 55 1 287 1 dmsC Anaerobic dimethyl sulfoxide reductase chain C Escherichia coli (strain K12)
P76173 1.8e-88 268 53 2 283 3 ynfH Anaerobic dimethyl sulfoxide reductase chain YnfH Escherichia coli (strain K12)
P45002 1.04e-63 204 41 6 286 3 dmsC Anaerobic dimethyl sulfoxide reductase chain C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_13340
Feature type CDS
Gene dmsC
Product DMSO reductase anchor subunit DmsC
Location 91918 - 92778 (strand: -1)
Length 861 (nucleotides) / 286 (amino acids)
In genomic island -

Contig

Accession ZDB_691
Length 141725 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_301
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF04976 DMSO reductase anchor subunit (DmsC)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3302 Energy production and conversion (C) C DMSO reductase anchor subunit DmsC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07308 anaerobic dimethyl sulfoxide reductase subunit C Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
-

Protein Sequence

MGSGIHEWPLMFFTTIGQSVAGAFIVMAAVLLSGKLSPELNRKVHYSMFGLWVLMGVGFLLSMMHMGTPLRAFNAFNRLGSSSLSNEIAAGSVFFAAGGFYWLLAVLNKMPAALGKLWLLVVMVLAVVFIYAIPQVYQIATVPTWYTPYTTVHFVLTALLGGPVLAALLLRIAGFDLRCISWLPLVGIVALVASAVAVTSQAFDLAFIRSSVQSASALVPEFGLYMGWRLVLLALGLTCWILPLVKRTNPPVIMMLIGFVLVLSGEIIGRGIFYGLHMTAGMAYLS

Flanking regions ( +/- flanking 50bp)

TCCTGTCGGGGATACCACAGGCCATCTGGCGAACCCGGAGGAGGTATAACATGGGATCGGGAATTCATGAATGGCCGCTGATGTTTTTTACCACCATCGGGCAGAGTGTGGCAGGGGCATTTATTGTGATGGCGGCAGTGCTGCTGTCCGGAAAACTGTCACCGGAACTGAACCGTAAAGTGCATTACAGCATGTTCGGCCTGTGGGTGCTGATGGGCGTGGGTTTCCTGCTCTCCATGATGCACATGGGCACGCCGCTGCGTGCGTTTAATGCGTTTAACCGCCTCGGCAGTTCATCGCTCAGTAATGAAATTGCGGCCGGTTCGGTCTTCTTCGCTGCCGGTGGTTTTTACTGGCTGCTGGCGGTGCTGAACAAAATGCCGGCGGCGCTCGGTAAGCTCTGGCTGCTGGTGGTAATGGTTCTCGCGGTGGTCTTTATTTACGCCATTCCGCAGGTTTACCAGATTGCCACGGTGCCGACCTGGTATACCCCGTACACCACGGTTCACTTTGTGCTGACAGCTCTGCTGGGCGGGCCGGTACTGGCTGCTCTGCTGCTGCGGATTGCCGGGTTTGACCTGCGCTGCATCAGCTGGCTGCCGCTGGTGGGTATCGTTGCGCTGGTGGCGAGTGCGGTCGCAGTGACGTCACAGGCGTTTGATCTGGCCTTTATCCGCAGTTCCGTACAGAGCGCTTCCGCGCTGGTACCGGAATTCGGCCTGTATATGGGCTGGCGTCTGGTTCTGCTGGCGCTGGGTCTGACCTGTTGGATCCTGCCGCTGGTGAAACGGACAAATCCGCCGGTGATTATGATGCTGATTGGTTTTGTTCTGGTGTTATCCGGGGAAATTATCGGCCGCGGTATTTTCTACGGACTGCACATGACAGCCGGTATGGCCTATCTGTCCTGATACAGTCAGCACGTATCCTGTTACTGTTTTCCGGACGGAAACCGTGGCAG