Homologs in group_159

Help

8 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10515 FBDBKF_10515 100.0 Morganella morganii S1 fimC P pilus assembly protein, chaperone PapD
EHELCC_14850 EHELCC_14850 100.0 Morganella morganii S2 fimC P pilus assembly protein, chaperone PapD
NLDBIP_14680 NLDBIP_14680 100.0 Morganella morganii S4 fimC P pilus assembly protein, chaperone PapD
LHKJJB_14665 LHKJJB_14665 100.0 Morganella morganii S3 fimC P pilus assembly protein, chaperone PapD
F4V73_RS01855 F4V73_RS01855 33.8 Morganella psychrotolerans - molecular chaperone
F4V73_RS10895 F4V73_RS10895 37.9 Morganella psychrotolerans - molecular chaperone
F4V73_RS14225 F4V73_RS14225 73.1 Morganella psychrotolerans - molecular chaperone
PMI_RS10905 PMI_RS10905 35.0 Proteus mirabilis HI4320 - molecular chaperone

Distribution of the homologs in the orthogroup group_159

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_159

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8X5K6 1.11e-42 147 37 5 219 2 lpfB Probable fimbrial chaperone LpfB Escherichia coli O157:H7
P62609 1.09e-36 131 33 5 220 1 focC Chaperone protein FocC Escherichia coli
P62610 1.09e-36 131 33 5 220 3 focC Chaperone protein FocC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P53520 7.82e-35 127 33 6 235 3 pmfD Chaperone protein PmfD Proteus mirabilis (strain HI4320)
P31697 1.04e-34 126 35 5 209 1 fimC Chaperone protein FimC Escherichia coli (strain K12)
P43661 1.32e-32 121 35 8 221 3 lpfB Chaperone protein LpfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P59590 1.67e-32 121 34 5 209 3 fimC Chaperone protein FimC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P37923 8.95e-30 113 34 5 204 3 fimC Chaperone protein FimC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P77599 2.48e-29 113 33 5 206 2 yfcS Probable fimbrial chaperone YfcS Escherichia coli (strain K12)
P25402 1.26e-28 110 34 8 224 3 fanE Chaperone protein FanE Escherichia coli
P77249 1.91e-27 107 31 7 226 2 sfmC Probable fimbrial chaperone SfmC Escherichia coli (strain K12)
P21646 7.87e-27 106 32 7 212 3 mrkB Chaperone protein MrkB Klebsiella pneumoniae
P77616 7.25e-25 101 28 7 225 3 yqiH Uncharacterized fimbrial chaperone YqiH Escherichia coli (strain K12)
P42914 1.22e-24 100 32 4 201 2 yraI Probable fimbrial chaperone YraI Escherichia coli (strain K12)
P75856 4.2e-24 99 32 7 219 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli (strain K12)
Q8X5E4 5.13e-24 98 32 7 219 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli O157:H7
P33128 5.28e-24 99 32 9 237 1 yadV Probable fimbrial chaperone YadV Escherichia coli (strain K12)
P33342 1.44e-23 97 31 6 219 2 yehC Probable fimbrial chaperone YehC Escherichia coli (strain K12)
P26926 4.4e-23 97 30 9 231 1 caf1M Chaperone protein caf1M Yersinia pestis
P15319 4.6e-23 96 29 8 233 1 papD Chaperone protein PapD Escherichia coli
P53516 7.4e-23 95 33 6 190 3 afaB Chaperone protein AfaB Escherichia coli
P33409 9.9e-21 90 35 7 185 3 fimB Chaperone protein FimB/FhaD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P15483 1.64e-20 89 33 7 207 3 None Chaperone protein CS3-1 Escherichia coli
P46004 1.39e-19 87 32 11 212 3 aggD Chaperone protein AggD Escherichia coli
P33407 6.72e-19 85 29 8 213 3 myfB Chaperone protein MyfB Yersinia enterocolitica
P25401 8.09e-19 85 27 6 211 1 faeE Chaperone protein FaeE Escherichia coli
P53519 1.41e-18 84 29 6 212 3 cssC Chaperone protein CssC Escherichia coli
P75749 1.58e-18 84 29 8 202 3 ybgP Uncharacterized fimbrial chaperone YbgP Escherichia coli (strain K12)
P46738 6.23e-18 82 31 6 190 3 nfaE Chaperone protein NfaE Escherichia coli
P53518 6.56e-18 82 28 7 225 3 cssC Chaperone protein CssC Escherichia coli
P33387 7e-18 82 30 6 220 3 sefB Chaperone protein SefB Salmonella enteritidis
Q05433 8.02e-18 82 27 6 211 3 clpE Chaperone protein ClpE Escherichia coli
P45991 2.28e-17 81 27 9 237 3 hifB Chaperone protein HifB Haemophilus influenzae
P35757 2.24e-16 78 27 9 237 3 hifB Chaperone protein HifB Haemophilus influenzae
P40876 3.99e-16 77 29 8 221 2 ycbF Uncharacterized fimbrial chaperone YcbF Escherichia coli (strain K12)
P69966 1.22e-15 77 27 6 218 3 psaB Chaperone protein PsaB Yersinia pseudotuberculosis serotype I (strain IP32953)
P69965 1.22e-15 77 27 6 218 3 psaB Chaperone protein PsaB Yersinia pestis
P28722 5.47e-05 46 21 2 152 3 yhcA Uncharacterized fimbrial chaperone YhcA Escherichia coli (strain K12)
P42183 0.000171 43 30 5 110 3 prsD Chaperone protein PrsD (Fragment) Escherichia coli

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_13285
Feature type CDS
Gene fimC
Product P pilus assembly protein, chaperone PapD
Location 79983 - 80669 (strand: 1)
Length 687 (nucleotides) / 228 (amino acids)
In genomic island -

Contig

Accession ZDB_691
Length 141725 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_159
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF00345 Pili and flagellar-assembly chaperone, PapD N-terminal domain
PF02753 Pili assembly chaperone PapD, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3121 Extracellular structures (W) W P pilus assembly protein, chaperone PapD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07346 fimbrial chaperone protein Two-component system -

Protein Sequence

MFTKTNILSACALLLLVSESYAGFGLETTRVIYHEKNNSEGVVAFNTDKGRNYLLQSWVEDKAGNVSPDFVSTPPLVKLRAEKKNTLQITKVASLPADRESLYWLNVKFVAPSEEGQENVLRYSMTNRIKILYRPAALDNSRDIESYANKLDWSVSGNRLTVNNSTPYYVNISKITVNNQEVKLPAGYISPKSVETITVPQAIKAPANVKLTYINDYGKAVELSYSAK

Flanking regions ( +/- flanking 50bp)

ATGAAATACTCTGCGCGCCCTCACTATAATAAAATAACCAAGGCTTAATCATGTTCACTAAAACAAATATTCTCTCTGCTTGTGCATTACTTCTTTTGGTATCAGAAAGCTATGCCGGTTTTGGTTTAGAAACAACCCGCGTTATTTATCATGAAAAAAATAACAGCGAGGGTGTTGTTGCCTTTAATACCGACAAAGGCAGAAATTATCTTTTGCAGTCATGGGTTGAAGATAAAGCAGGAAATGTCAGCCCTGATTTTGTTTCAACACCACCACTCGTCAAATTACGGGCTGAAAAAAAGAATACATTACAGATCACAAAAGTGGCGTCATTACCGGCTGACAGAGAGTCTCTTTACTGGCTGAATGTTAAGTTTGTGGCGCCGAGTGAGGAAGGCCAGGAAAACGTTCTGCGCTACTCGATGACCAACAGAATAAAAATCCTGTATCGTCCGGCGGCTCTCGATAACAGCCGTGATATTGAAAGCTATGCAAATAAGTTAGACTGGTCTGTTTCAGGTAACCGCCTTACGGTTAATAACAGCACGCCTTATTATGTAAATATTTCAAAAATCACCGTCAACAACCAGGAAGTAAAACTGCCTGCCGGATATATATCGCCTAAATCGGTGGAAACAATAACTGTCCCGCAGGCAATTAAAGCACCTGCAAATGTAAAACTGACATACATAAATGATTACGGTAAAGCCGTTGAATTAAGTTATTCTGCTAAATAACAGATGATAATGATGATGAAAAAATATCATAATAAAAACCATTTTATGTC