Homologs in group_2825

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10060 FBDBKF_10060 100.0 Morganella morganii S1 hxlR DNA-binding transcriptional regulator, HxlR family
EHELCC_04860 EHELCC_04860 100.0 Morganella morganii S2 hxlR DNA-binding transcriptional regulator, HxlR family
NLDBIP_04860 NLDBIP_04860 100.0 Morganella morganii S4 hxlR DNA-binding transcriptional regulator, HxlR family
LHKJJB_13770 LHKJJB_13770 100.0 Morganella morganii S3 hxlR DNA-binding transcriptional regulator, HxlR family
F4V73_RS00275 F4V73_RS00275 88.7 Morganella psychrotolerans - helix-turn-helix domain-containing protein

Distribution of the homologs in the orthogroup group_2825

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2825

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9Z9W1 5.11e-27 99 49 0 93 4 BH0655 Uncharacterized HTH-type transcriptional regulator BH0655 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P42406 6.14e-26 96 49 1 103 1 hxlR HTH-type transcriptional activator HxlR Bacillus subtilis (strain 168)
O27346 2.52e-25 95 47 2 103 4 MTH_1285 Uncharacterized HTH-type transcriptional regulator MTH_1285 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q93K57 2.96e-25 94 47 0 93 4 malR Putative regulatory protein MalR Fusobacterium mortiferum
O34533 3.26e-25 95 45 2 105 1 ytcD Uncharacterized HTH-type transcriptional regulator YtcD Bacillus subtilis (strain 168)
P96673 1.25e-23 91 47 2 97 4 ydeP Uncharacterized HTH-type transcriptional regulator YdeP Bacillus subtilis (strain 168)
P37486 1.89e-23 90 47 1 93 1 yybR Uncharacterized HTH-type transcriptional regulator YybR Bacillus subtilis (strain 168)
O31679 4.05e-22 87 44 2 109 4 ykvN Uncharacterized HTH-type transcriptional regulator YkvN Bacillus subtilis (strain 168)
O31494 8.38e-22 85 41 0 97 4 ydzF Uncharacterized HTH-type transcriptional regulator YdzF Bacillus subtilis (strain 168)
O32238 8.98e-15 67 44 0 67 4 yvaP Uncharacterized HTH-type transcriptional regulator YvaP Bacillus subtilis (strain 168)
P72979 6.62e-13 63 35 2 96 4 sll1512 Uncharacterized HTH-type transcriptional regulator sll1512 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O34844 6.36e-11 58 34 1 94 1 yodB HTH-type transcriptional regulator YodB Bacillus subtilis (strain 168)
P0ACN3 2.43e-10 57 35 1 85 4 ytfH Uncharacterized HTH-type transcriptional regulator YtfH Shigella flexneri
P0ACN2 2.43e-10 57 35 1 85 4 ytfH Uncharacterized HTH-type transcriptional regulator YtfH Escherichia coli (strain K12)
P0A649 1.18e-06 47 33 4 101 4 BQ2027_MB3122 Uncharacterized HTH-type transcriptional regulator Mb3122 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMG3 1.18e-06 47 33 4 101 1 Rv3095 Uncharacterized HTH-type transcriptional regulator Rv3095 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMG2 1.44e-06 47 33 4 101 4 MT3179 Uncharacterized HTH-type transcriptional regulator MT3179 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_12765
Feature type CDS
Gene hxlR
Product DNA-binding transcriptional regulator, HxlR family
Location 106312 - 106671 (strand: 1)
Length 360 (nucleotides) / 119 (amino acids)

Contig

Accession ZDB_690
Length 144397 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2825
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01638 HxlR-like helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1733 Transcription (K) K DNA-binding transcriptional regulator, HxlR family

Protein Sequence

MDDKIKKIVVVSEIEVTLSVIGGKYKPLILNLLSEKTVQRFGEIRAYIVNISQKTLTNQLREMEADGLLTRTVFAEVPPRVEYTITDKGRSLIPILLLMCDWGYENMGDRYTLLRPECD

Flanking regions ( +/- flanking 50bp)

CATATATCAAGAAGGCAGATTTATTTCACAAAGTAACCTGAAGGTAACTAATGGACGATAAAATAAAGAAAATTGTAGTGGTCAGTGAAATAGAAGTTACGCTGTCGGTTATCGGCGGGAAATATAAACCGTTAATATTAAATTTATTATCTGAAAAAACCGTTCAGCGTTTCGGGGAAATACGGGCTTATATTGTCAATATTTCACAAAAAACATTAACCAATCAATTACGCGAGATGGAAGCGGACGGCCTGCTGACCCGGACGGTCTTTGCCGAAGTGCCGCCCCGCGTGGAATATACTATTACAGACAAAGGCCGTTCCCTGATCCCGATTCTGCTGCTGATGTGTGACTGGGGTTATGAGAATATGGGCGACCGCTACACACTGCTGCGCCCGGAGTGTGACTGAGCCGCTGTTACCGGCTGCAGTATTGCCTGATCACACAGATAATCTGTCTG