Homologs in group_60

Help

12 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07785 FBDBKF_07785 82.9 Morganella morganii S1 hxlR DNA-binding transcriptional regulator, HxlR family
FBDBKF_10060 FBDBKF_10060 43.0 Morganella morganii S1 hxlR DNA-binding transcriptional regulator, HxlR family
EHELCC_04860 EHELCC_04860 43.0 Morganella morganii S2 hxlR DNA-binding transcriptional regulator, HxlR family
EHELCC_13615 EHELCC_13615 82.9 Morganella morganii S2 hxlR DNA-binding transcriptional regulator, HxlR family
NLDBIP_04860 NLDBIP_04860 43.0 Morganella morganii S4 hxlR DNA-binding transcriptional regulator, HxlR family
NLDBIP_14060 NLDBIP_14060 82.9 Morganella morganii S4 hxlR DNA-binding transcriptional regulator, HxlR family
LHKJJB_08790 LHKJJB_08790 82.9 Morganella morganii S3 hxlR DNA-binding transcriptional regulator, HxlR family
LHKJJB_13770 LHKJJB_13770 43.0 Morganella morganii S3 hxlR DNA-binding transcriptional regulator, HxlR family
HKOGLL_08340 HKOGLL_08340 82.9 Morganella morganii S5 hxlR DNA-binding transcriptional regulator, HxlR family
HKOGLL_12765 HKOGLL_12765 43.0 Morganella morganii S5 hxlR DNA-binding transcriptional regulator, HxlR family
F4V73_RS00275 F4V73_RS00275 40.5 Morganella psychrotolerans - helix-turn-helix domain-containing protein
F4V73_RS01030 F4V73_RS01030 28.9 Morganella psychrotolerans - helix-turn-helix domain-containing protein

Distribution of the homologs in the orthogroup group_60

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_60

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P96673 1.97e-40 134 60 0 102 4 ydeP Uncharacterized HTH-type transcriptional regulator YdeP Bacillus subtilis (strain 168)
P37486 4.59e-39 130 62 0 96 1 yybR Uncharacterized HTH-type transcriptional regulator YybR Bacillus subtilis (strain 168)
O34533 2.36e-28 103 58 0 93 1 ytcD Uncharacterized HTH-type transcriptional regulator YtcD Bacillus subtilis (strain 168)
P42406 2.67e-28 102 55 1 95 1 hxlR HTH-type transcriptional activator HxlR Bacillus subtilis (strain 168)
O31679 7.36e-28 101 53 0 96 4 ykvN Uncharacterized HTH-type transcriptional regulator YkvN Bacillus subtilis (strain 168)
O27346 4.82e-27 100 50 0 95 4 MTH_1285 Uncharacterized HTH-type transcriptional regulator MTH_1285 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q93K57 1.22e-24 93 45 2 111 4 malR Putative regulatory protein MalR Fusobacterium mortiferum
Q9Z9W1 2.45e-20 82 48 1 94 4 BH0655 Uncharacterized HTH-type transcriptional regulator BH0655 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O31494 1.81e-19 80 46 1 97 4 ydzF Uncharacterized HTH-type transcriptional regulator YdzF Bacillus subtilis (strain 168)
O34844 1.44e-17 75 34 1 98 1 yodB HTH-type transcriptional regulator YodB Bacillus subtilis (strain 168)
O32238 9.04e-17 73 31 1 104 4 yvaP Uncharacterized HTH-type transcriptional regulator YvaP Bacillus subtilis (strain 168)
P72979 1.47e-16 73 37 0 91 4 sll1512 Uncharacterized HTH-type transcriptional regulator sll1512 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0ACN3 1.72e-14 67 37 0 105 4 ytfH Uncharacterized HTH-type transcriptional regulator YtfH Shigella flexneri
P0ACN2 1.72e-14 67 37 0 105 4 ytfH Uncharacterized HTH-type transcriptional regulator YtfH Escherichia coli (strain K12)
P0A649 1.99e-08 52 34 1 98 4 BQ2027_MB3122 Uncharacterized HTH-type transcriptional regulator Mb3122 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMG3 1.99e-08 52 34 1 98 1 Rv3095 Uncharacterized HTH-type transcriptional regulator Rv3095 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMG2 3.22e-08 52 34 1 98 4 MT3179 Uncharacterized HTH-type transcriptional regulator MT3179 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS13260
Feature type CDS
Gene -
Product helix-turn-helix domain-containing protein
Location 278893 - 279264 (strand: -1)
Length 372 (nucleotides) / 123 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000003
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_60
Orthogroup size 13
N. genomes 6

Actions

Genomic region

Domains

PF01638 HxlR-like helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1733 Transcription (K) K DNA-binding transcriptional regulator, HxlR family

Protein Sequence

MDTVKKTRYESYAYEACPVEASLELMGGKGKGMILYHLISGTKRFNELRRHLVFITPRMLTKQLRELEAAELIHREVYPQVPPKVEYSLTAAGESLTPILLMLKSWGEAHALPVLMKRQMPQP

Flanking regions ( +/- flanking 50bp)

CCATGATGTATTTTTAACAAGTACGCACATTTTTGGTATATAGGTACAAAATGGATACTGTAAAAAAGACCCGCTACGAGTCATACGCTTATGAAGCCTGTCCGGTGGAAGCATCACTGGAACTGATGGGCGGAAAAGGAAAAGGGATGATCCTTTATCATCTGATCAGTGGAACAAAACGGTTTAATGAACTGCGGCGGCATCTGGTATTTATTACGCCGCGTATGCTGACAAAGCAGTTACGTGAGCTGGAAGCCGCTGAACTGATCCACCGGGAAGTGTATCCGCAAGTGCCGCCGAAAGTGGAATACAGCTTGACGGCAGCAGGTGAATCACTGACGCCGATATTACTGATGCTCAAAAGCTGGGGAGAAGCGCACGCGCTGCCGGTACTGATGAAAAGACAGATGCCACAGCCCTGAAACCGGCTGCGGTTTTTATACCCTTATTCATTCAAACTGCAGGTTCGTTG