Homologs in group_1282

Help

6 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07785 FBDBKF_07785 100.0 Morganella morganii S1 hxlR DNA-binding transcriptional regulator, HxlR family
NLDBIP_14060 NLDBIP_14060 100.0 Morganella morganii S4 hxlR DNA-binding transcriptional regulator, HxlR family
LHKJJB_08790 LHKJJB_08790 100.0 Morganella morganii S3 hxlR DNA-binding transcriptional regulator, HxlR family
HKOGLL_08340 HKOGLL_08340 100.0 Morganella morganii S5 hxlR DNA-binding transcriptional regulator, HxlR family
F4V73_RS01030 F4V73_RS01030 32.5 Morganella psychrotolerans - helix-turn-helix domain-containing protein
F4V73_RS13260 F4V73_RS13260 82.9 Morganella psychrotolerans - helix-turn-helix domain-containing protein

Distribution of the homologs in the orthogroup group_1282

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1282

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P96673 1.27e-40 134 59 0 102 4 ydeP Uncharacterized HTH-type transcriptional regulator YdeP Bacillus subtilis (strain 168)
P37486 9.97e-39 129 61 0 96 1 yybR Uncharacterized HTH-type transcriptional regulator YybR Bacillus subtilis (strain 168)
O34533 6.61e-30 107 59 0 93 1 ytcD Uncharacterized HTH-type transcriptional regulator YtcD Bacillus subtilis (strain 168)
O31679 2.88e-29 105 55 0 96 4 ykvN Uncharacterized HTH-type transcriptional regulator YkvN Bacillus subtilis (strain 168)
Q93K57 3.42e-26 97 47 2 111 4 malR Putative regulatory protein MalR Fusobacterium mortiferum
P42406 5.06e-26 97 56 1 93 1 hxlR HTH-type transcriptional activator HxlR Bacillus subtilis (strain 168)
O27346 7.08e-26 97 49 0 95 4 MTH_1285 Uncharacterized HTH-type transcriptional regulator MTH_1285 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
O31494 4.97e-21 84 46 1 97 4 ydzF Uncharacterized HTH-type transcriptional regulator YdzF Bacillus subtilis (strain 168)
Q9Z9W1 8.1e-21 83 51 1 94 4 BH0655 Uncharacterized HTH-type transcriptional regulator BH0655 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O32238 3.01e-19 79 36 1 104 4 yvaP Uncharacterized HTH-type transcriptional regulator YvaP Bacillus subtilis (strain 168)
P72979 2.23e-15 70 34 0 93 4 sll1512 Uncharacterized HTH-type transcriptional regulator sll1512 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O34844 2.92e-15 69 33 1 98 1 yodB HTH-type transcriptional regulator YodB Bacillus subtilis (strain 168)
P0ACN3 1.18e-11 60 35 0 94 4 ytfH Uncharacterized HTH-type transcriptional regulator YtfH Shigella flexneri
P0ACN2 1.18e-11 60 35 0 94 4 ytfH Uncharacterized HTH-type transcriptional regulator YtfH Escherichia coli (strain K12)
P0A649 8.97e-11 58 33 2 115 4 BQ2027_MB3122 Uncharacterized HTH-type transcriptional regulator Mb3122 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMG3 8.97e-11 58 33 2 115 1 Rv3095 Uncharacterized HTH-type transcriptional regulator Rv3095 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMG2 1.54e-10 58 33 2 115 4 MT3179 Uncharacterized HTH-type transcriptional regulator MT3179 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_13615
Feature type CDS
Gene hxlR
Product DNA-binding transcriptional regulator, HxlR family
Location 52853 - 53224 (strand: 1)
Length 372 (nucleotides) / 123 (amino acids)

Contig

Accession ZDB_223
Length 138954 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1282
Orthogroup size 7
N. genomes 6

Actions

Genomic region

Domains

PF01638 HxlR-like helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1733 Transcription (K) K DNA-binding transcriptional regulator, HxlR family

Protein Sequence

MDTVRKTRYESYAYEACPVEATLEMMGGKGKGMILYHLISGIKRFNELKRLLIFITPRMLTKQLRELEIAGLVHRKVYAEVPPKVEYSLTDAGQSLVPILLMLKSWGEEHALPVLLQQQTPQP

Flanking regions ( +/- flanking 50bp)

CTATGATATGTTTTTAACAAGTACGTACATTTTTGGTATATAGGTACAAAATGGATACTGTCAGAAAGACGCGTTACGAATCGTATGCTTATGAGGCCTGTCCGGTTGAGGCAACACTGGAAATGATGGGCGGGAAGGGCAAGGGAATGATCCTTTACCATCTGATAAGCGGCATCAAACGCTTTAACGAGCTGAAACGGCTGCTGATATTTATTACCCCGCGTATGCTGACAAAACAGTTACGGGAGCTTGAGATAGCGGGGCTTGTCCACCGCAAGGTCTATGCGGAGGTGCCGCCGAAAGTGGAATACAGCCTGACGGACGCCGGGCAGTCGCTGGTACCGATCTTACTGATGCTGAAAAGCTGGGGGGAAGAACATGCCCTGCCGGTACTTTTGCAGCAACAGACACCGCAACCCTGACACCGCCGTCCTGAAGACGGACGGTGTCTATTTTCTGCGGTTTACTGATT