Homologs in group_1402

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08340 FBDBKF_08340 100.0 Morganella morganii S1 yifL Small periplasmic lipoprotein YifL (function unknown)
EHELCC_13185 EHELCC_13185 100.0 Morganella morganii S2 yifL Small periplasmic lipoprotein YifL (function unknown)
NLDBIP_13525 NLDBIP_13525 100.0 Morganella morganii S4 yifL Small periplasmic lipoprotein YifL (function unknown)
LHKJJB_13030 LHKJJB_13030 100.0 Morganella morganii S3 yifL Small periplasmic lipoprotein YifL (function unknown)
F4V73_RS09540 F4V73_RS09540 69.8 Morganella psychrotolerans - lipoprotein
PMI_RS19145 PMI_RS19145 50.0 Proteus mirabilis HI4320 - lipoprotein

Distribution of the homologs in the orthogroup group_1402

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1402

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADN9 8.18e-06 42 42 1 49 3 yifL Uncharacterized lipoprotein YifL Shigella flexneri
P0ADN6 8.18e-06 42 42 1 49 1 yifL Uncharacterized lipoprotein YifL Escherichia coli (strain K12)
P0ADN7 8.18e-06 42 42 1 49 3 yifL Uncharacterized lipoprotein YifL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ADN8 8.18e-06 42 42 1 49 3 yifL Uncharacterized lipoprotein YifL Escherichia coli O157:H7
P0A1T6 5.88e-05 39 50 1 40 3 yifL Uncharacterized lipoprotein YifL Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1T7 5.88e-05 39 50 1 40 3 yifL Uncharacterized lipoprotein YifL Salmonella typhi

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_12000
Feature type CDS
Gene yifL
Product Small periplasmic lipoprotein YifL (function unknown)
Location 119523 - 119714 (strand: -1)
Length 192 (nucleotides) / 63 (amino acids)
In genomic island -

Contig

Accession ZDB_689
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1402
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13627 Prokaryotic lipoprotein-attachment site

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG5567 Function unknown (S) S Small periplasmic lipoprotein YifL (function unknown)

Protein Sequence

MKKKMICAVSAVMLLTLSGCGLKGPLYFPPEEPAAAKSAPAAKPAAEQSAVQTDNAETGKTQK

Flanking regions ( +/- flanking 50bp)

AACTGCGATTATAGAGGGTATTGACCGATGATTAACAGGCATGACTGTAAATGAAGAAAAAAATGATCTGTGCGGTATCCGCCGTGATGCTGCTGACCCTGTCCGGCTGCGGACTGAAAGGCCCGCTTTACTTCCCGCCGGAAGAGCCTGCCGCCGCGAAAAGCGCGCCTGCAGCCAAGCCTGCGGCAGAGCAGTCTGCTGTGCAGACTGACAACGCTGAGACCGGCAAAACGCAAAAATGACCACCGGATAACCCCGGTTACTGAGGCGTAAACAGGATCTGAACATGCAG