Homologs in group_2077

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15285 FBDBKF_15285 100.0 Morganella morganii S1 luxS S-ribosylhomocysteine lyase
EHELCC_10960 EHELCC_10960 100.0 Morganella morganii S2 luxS S-ribosylhomocysteine lyase
NLDBIP_11305 NLDBIP_11305 100.0 Morganella morganii S4 luxS S-ribosylhomocysteine lyase
LHKJJB_11165 LHKJJB_11165 100.0 Morganella morganii S3 luxS S-ribosylhomocysteine lyase
F4V73_RS12165 F4V73_RS12165 94.7 Morganella psychrotolerans luxS S-ribosylhomocysteine lyase
PMI_RS01840 PMI_RS01840 73.7 Proteus mirabilis HI4320 luxS S-ribosylhomocysteine lyase

Distribution of the homologs in the orthogroup group_2077

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2077

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1LPG2 9.77e-102 292 78 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli (strain SMS-3-5 / SECEC)
Q8FEP8 9.77e-102 292 78 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEI8 9.77e-102 292 78 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MYZ0 9.77e-102 292 78 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli O81 (strain ED1a)
B7NSH2 1.53e-101 292 78 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5XVC4 1.84e-101 291 79 0 170 3 luxS S-ribosylhomocysteine lyase Klebsiella pneumoniae (strain 342)
Q0T1B8 2.01e-101 291 77 0 170 3 luxS S-ribosylhomocysteine lyase Shigella flexneri serotype 5b (strain 8401)
Q31X57 2.01e-101 291 77 0 170 3 luxS S-ribosylhomocysteine lyase Shigella boydii serotype 4 (strain Sb227)
B2U054 2.01e-101 291 77 0 170 3 luxS S-ribosylhomocysteine lyase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I678 2.56e-101 291 77 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli (strain SE11)
B7M9C9 2.56e-101 291 77 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli O8 (strain IAI1)
B7LEA1 2.56e-101 291 77 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli (strain 55989 / EAEC)
Q3YYH1 4.95e-101 290 77 0 170 3 luxS S-ribosylhomocysteine lyase Shigella sonnei (strain Ss046)
Q32CN6 4.95e-101 290 77 0 170 3 luxS S-ribosylhomocysteine lyase Shigella dysenteriae serotype 1 (strain Sd197)
B7LVZ2 4.95e-101 290 77 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R809 4.95e-101 290 77 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli (strain UTI89 / UPEC)
B7N6S2 4.95e-101 290 77 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P45578 4.95e-101 290 77 0 170 1 luxS S-ribosylhomocysteine lyase Escherichia coli (strain K12)
B1IUY7 4.95e-101 290 77 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A1AEN2 4.95e-101 290 77 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli O1:K1 / APEC
A8A3G9 4.95e-101 290 77 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli O9:H4 (strain HS)
B1XCM0 4.95e-101 290 77 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli (strain K12 / DH10B)
C4ZYT7 4.95e-101 290 77 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli (strain K12 / MC4100 / BW2952)
B7MKG1 4.95e-101 290 77 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UHB0 4.95e-101 290 77 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZQC0 4.95e-101 290 77 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli O139:H28 (strain E24377A / ETEC)
A8ANP5 9.15e-101 290 77 0 170 3 luxS S-ribosylhomocysteine lyase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4WDQ1 1.03e-100 290 78 0 170 3 luxS S-ribosylhomocysteine lyase Enterobacter sp. (strain 638)
B5Z2A2 2.18e-100 289 77 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X902 2.18e-100 289 77 0 170 3 luxS S-ribosylhomocysteine lyase Escherichia coli O157:H7
Q83JZ4 2.38e-100 289 77 0 170 3 luxS S-ribosylhomocysteine lyase Shigella flexneri
Q9L4T0 5.77e-100 288 77 0 170 3 luxS S-ribosylhomocysteine lyase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TSZ9 5.77e-100 288 77 0 170 3 luxS S-ribosylhomocysteine lyase Salmonella schwarzengrund (strain CVM19633)
B5BEN0 5.77e-100 288 77 0 170 3 luxS S-ribosylhomocysteine lyase Salmonella paratyphi A (strain AKU_12601)
C0PWL6 5.77e-100 288 77 0 170 3 luxS S-ribosylhomocysteine lyase Salmonella paratyphi C (strain RKS4594)
Q5PF11 5.77e-100 288 77 0 170 3 luxS S-ribosylhomocysteine lyase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T393 5.77e-100 288 77 0 170 3 luxS S-ribosylhomocysteine lyase Salmonella newport (strain SL254)
B4TF05 5.77e-100 288 77 0 170 3 luxS S-ribosylhomocysteine lyase Salmonella heidelberg (strain SL476)
B5RDE7 5.77e-100 288 77 0 170 3 luxS S-ribosylhomocysteine lyase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QV71 5.77e-100 288 77 0 170 3 luxS S-ribosylhomocysteine lyase Salmonella enteritidis PT4 (strain P125109)
B5FSX3 5.77e-100 288 77 0 170 3 luxS S-ribosylhomocysteine lyase Salmonella dublin (strain CT_02021853)
Q57KV4 5.77e-100 288 77 0 170 3 luxS S-ribosylhomocysteine lyase Salmonella choleraesuis (strain SC-B67)
B5F345 5.77e-100 288 77 0 170 3 luxS S-ribosylhomocysteine lyase Salmonella agona (strain SL483)
A0KG57 2.64e-99 286 78 0 169 3 luxS S-ribosylhomocysteine lyase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q8Z4D7 1.01e-98 285 76 0 170 1 luxS S-ribosylhomocysteine lyase Salmonella typhi
A4SIY8 2.01e-98 284 77 0 169 3 luxS S-ribosylhomocysteine lyase Aeromonas salmonicida (strain A449)
A7MJ28 2.35e-98 284 77 0 170 3 luxS S-ribosylhomocysteine lyase Cronobacter sakazakii (strain ATCC BAA-894)
Q2NVK8 2.9e-98 283 77 0 170 3 luxS S-ribosylhomocysteine lyase Sodalis glossinidius (strain morsitans)
A1JK16 3.27e-98 283 78 0 170 3 luxS S-ribosylhomocysteine lyase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q9JWB0 8.17e-98 282 80 0 163 3 luxS S-ribosylhomocysteine lyase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9MFZ6 9.78e-98 282 75 0 170 3 luxS S-ribosylhomocysteine lyase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8KM01 1.24e-97 282 76 0 169 3 luxS S-ribosylhomocysteine lyase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q684Q1 6.66e-97 280 78 0 170 3 luxS S-ribosylhomocysteine lyase Serratia marcescens
B1JJ95 6.74e-97 280 77 0 170 3 luxS S-ribosylhomocysteine lyase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66E63 6.74e-97 280 77 0 170 3 luxS S-ribosylhomocysteine lyase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQ57 6.74e-97 280 77 0 170 3 luxS S-ribosylhomocysteine lyase Yersinia pestis (strain Pestoides F)
Q1CLK4 6.74e-97 280 77 0 170 3 luxS S-ribosylhomocysteine lyase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0V3 6.74e-97 280 77 0 170 3 luxS S-ribosylhomocysteine lyase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBU3 6.74e-97 280 77 0 170 3 luxS S-ribosylhomocysteine lyase Yersinia pestis
B2K5Y4 6.74e-97 280 77 0 170 3 luxS S-ribosylhomocysteine lyase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C416 6.74e-97 280 77 0 170 3 luxS S-ribosylhomocysteine lyase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLR2 6.74e-97 280 77 0 170 3 luxS S-ribosylhomocysteine lyase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A9M0P7 8.17e-97 280 79 0 163 3 luxS S-ribosylhomocysteine lyase Neisseria meningitidis serogroup C (strain 053442)
Q9JXL8 1.28e-96 279 79 0 163 3 luxS S-ribosylhomocysteine lyase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A8GA14 2.06e-96 279 77 0 170 3 luxS S-ribosylhomocysteine lyase Serratia proteamaculans (strain 568)
A1KW60 2.53e-96 278 79 0 163 3 luxS S-ribosylhomocysteine lyase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q6D1T5 2.08e-95 276 74 0 170 3 luxS S-ribosylhomocysteine lyase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DCQ4 3.89e-95 276 74 0 170 3 luxS S-ribosylhomocysteine lyase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B4RRB0 1.92e-94 274 77 0 166 3 luxS S-ribosylhomocysteine lyase Neisseria gonorrhoeae (strain NCCP11945)
Q5F534 1.92e-94 274 77 0 166 3 luxS S-ribosylhomocysteine lyase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A6VUX4 8.75e-94 272 75 0 168 3 luxS S-ribosylhomocysteine lyase Marinomonas sp. (strain MWYL1)
Q93LC7 9.67e-94 272 74 0 170 3 luxS S-ribosylhomocysteine lyase Proteus mirabilis
B4EUW0 9.67e-94 272 74 0 170 3 luxS S-ribosylhomocysteine lyase Proteus mirabilis (strain HI4320)
B8CKC3 1.71e-93 271 75 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella piezotolerans (strain WP3 / JCM 13877)
A3QH00 3.05e-93 271 76 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1S8N7 6.02e-93 270 75 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8H783 3.22e-92 268 75 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A8FYW3 3.44e-91 265 73 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella sediminis (strain HAW-EB3)
B1KD47 9.74e-91 265 72 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella woodyi (strain ATCC 51908 / MS32)
Q6TP45 1.07e-90 265 74 0 169 3 luxS S-ribosylhomocysteine lyase Vibrio alginolyticus
Q87LS4 1.1e-90 264 74 0 169 3 luxS S-ribosylhomocysteine lyase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B0TR04 1.17e-90 264 72 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella halifaxensis (strain HAW-EB4)
Q9Z5X1 1.3e-90 264 75 0 169 3 luxS S-ribosylhomocysteine lyase Vibrio campbellii (strain ATCC BAA-1116)
C3LS47 1.42e-90 264 73 0 169 3 luxS S-ribosylhomocysteine lyase Vibrio cholerae serotype O1 (strain M66-2)
Q9KUG4 1.42e-90 264 73 0 169 3 luxS S-ribosylhomocysteine lyase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F9A3 1.42e-90 264 73 0 169 3 luxS S-ribosylhomocysteine lyase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q0HLQ3 2.19e-90 263 73 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella sp. (strain MR-4)
Q8EHW1 2.27e-90 263 73 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1RN08 3.67e-90 263 73 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella sp. (strain W3-18-1)
A4Y3Y4 3.67e-90 263 73 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B5FAE1 3.85e-90 263 72 0 169 3 luxS S-ribosylhomocysteine lyase Aliivibrio fischeri (strain MJ11)
Q0HY34 6.86e-90 262 73 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella sp. (strain MR-7)
A0KTQ2 9.12e-90 262 73 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella sp. (strain ANA-3)
A9L0U6 1.37e-89 261 73 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella baltica (strain OS195)
A6WRX8 1.37e-89 261 73 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella baltica (strain OS185)
A3D134 1.37e-89 261 73 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EC51 1.37e-89 261 73 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella baltica (strain OS223)
P44007 5.31e-89 260 70 0 167 1 luxS S-ribosylhomocysteine lyase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q086L5 8.35e-89 259 72 0 169 3 luxS S-ribosylhomocysteine lyase Shewanella frigidimarina (strain NCIMB 400)
Q4QN52 1.39e-88 259 70 0 167 3 luxS S-ribosylhomocysteine lyase Haemophilus influenzae (strain 86-028NP)
A5U9Z9 1.66e-88 259 70 0 167 3 luxS S-ribosylhomocysteine lyase Haemophilus influenzae (strain PittEE)
A5UH01 1.79e-88 258 70 0 167 3 luxS S-ribosylhomocysteine lyase Haemophilus influenzae (strain PittGG)
A7ZGE2 1.82e-88 259 72 0 166 3 luxS S-ribosylhomocysteine lyase Campylobacter concisus (strain 13826)
Q7MHS7 3.6e-88 258 72 0 169 3 luxS S-ribosylhomocysteine lyase Vibrio vulnificus (strain YJ016)
Q9AHK1 3.6e-88 258 72 0 169 3 luxS S-ribosylhomocysteine lyase Vibrio vulnificus (strain CMCP6)
Q6LMV3 3.88e-88 258 73 0 169 3 luxS S-ribosylhomocysteine lyase Photobacterium profundum (strain SS9)
C5BGG6 4.33e-88 258 75 0 171 3 luxS S-ribosylhomocysteine lyase Edwardsiella ictaluri (strain 93-146)
P57901 1.41e-87 256 76 0 156 3 luxS S-ribosylhomocysteine lyase Pasteurella multocida (strain Pm70)
C4LCK3 4.09e-87 255 76 0 169 3 luxS S-ribosylhomocysteine lyase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B6EGB5 9.02e-87 254 71 0 169 3 luxS S-ribosylhomocysteine lyase Aliivibrio salmonicida (strain LFI1238)
A6VM61 4.12e-86 253 75 0 156 3 luxS S-ribosylhomocysteine lyase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A1SZZ2 1.05e-85 251 70 0 169 3 luxS S-ribosylhomocysteine lyase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q5HTR6 2.43e-85 251 68 0 163 3 luxS S-ribosylhomocysteine lyase Campylobacter jejuni (strain RM1221)
A8FMQ4 2.43e-85 251 68 0 163 3 luxS S-ribosylhomocysteine lyase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B0UVD9 3.03e-85 250 74 0 155 3 luxS S-ribosylhomocysteine lyase Histophilus somni (strain 2336)
B0BQF0 4.86e-85 250 72 1 164 3 luxS S-ribosylhomocysteine lyase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H1Y9 4.86e-85 250 72 1 164 3 luxS S-ribosylhomocysteine lyase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N1L8 4.86e-85 250 72 1 164 3 luxS S-ribosylhomocysteine lyase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A8ER22 8.06e-85 249 69 0 169 3 luxS S-ribosylhomocysteine lyase Aliarcobacter butzleri (strain RM4018)
Q9PN97 1.51e-84 248 68 0 163 3 luxS S-ribosylhomocysteine lyase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
B7VK33 2.91e-84 248 72 0 169 3 luxS S-ribosylhomocysteine lyase Vibrio atlanticus (strain LGP32)
Q3I354 4.28e-84 247 68 0 163 3 luxS S-ribosylhomocysteine lyase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q65VI4 7.68e-84 247 72 0 156 3 luxS S-ribosylhomocysteine lyase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q0I202 8.11e-84 247 73 0 155 3 luxS S-ribosylhomocysteine lyase Histophilus somni (strain 129Pt)
Q12QK7 8.77e-84 247 69 0 168 3 luxS S-ribosylhomocysteine lyase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q7VNV8 1.04e-83 246 68 1 169 3 luxS S-ribosylhomocysteine lyase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7MQP3 3.15e-83 245 68 0 162 3 luxS S-ribosylhomocysteine lyase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A7H2H9 2.64e-82 243 67 0 163 3 luxS S-ribosylhomocysteine lyase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q30P69 3.18e-82 243 69 0 166 3 luxS S-ribosylhomocysteine lyase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A6Q6Q3 3.97e-82 243 70 0 156 3 luxS S-ribosylhomocysteine lyase Sulfurovum sp. (strain NBC37-1)
Q31DQ6 1.77e-81 241 68 0 169 3 luxS S-ribosylhomocysteine lyase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A7I0U3 2.81e-81 240 66 0 163 3 luxS S-ribosylhomocysteine lyase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A7GWQ0 7.66e-81 239 68 0 161 3 luxS S-ribosylhomocysteine lyase Campylobacter curvus (strain 525.92)
B8F365 4.71e-80 237 68 1 164 3 luxS S-ribosylhomocysteine lyase Glaesserella parasuis serovar 5 (strain SH0165)
A0RM88 4.07e-79 235 69 0 161 3 luxS S-ribosylhomocysteine lyase Campylobacter fetus subsp. fetus (strain 82-40)
Q7VJR7 1.08e-77 231 65 0 163 3 luxS S-ribosylhomocysteine lyase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q9RRU8 5.82e-42 140 42 2 156 1 luxS S-ribosylhomocysteine lyase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q0TUQ5 1.61e-40 136 43 2 151 3 luxS S-ribosylhomocysteine lyase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0SWJ6 2.16e-40 136 43 2 151 3 luxS S-ribosylhomocysteine lyase Clostridium perfringens (strain SM101 / Type A)
Q9XDU6 2.16e-40 136 43 2 151 3 luxS S-ribosylhomocysteine lyase Clostridium perfringens (strain 13 / Type A)
Q1IW42 1.55e-39 134 41 2 156 3 luxS S-ribosylhomocysteine lyase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q03DR3 3.08e-39 134 43 1 148 3 luxS S-ribosylhomocysteine lyase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
C1CYB4 3.22e-38 131 40 2 156 3 luxS S-ribosylhomocysteine lyase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q041B8 1.01e-36 127 39 2 168 3 luxS S-ribosylhomocysteine lyase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q5SI29 6e-36 125 40 3 154 3 luxS S-ribosylhomocysteine lyase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72IE6 6e-36 125 40 3 154 3 luxS S-ribosylhomocysteine lyase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q74HV0 7.63e-36 125 38 2 168 3 luxS S-ribosylhomocysteine lyase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
B1MVP6 6.34e-35 122 43 4 150 3 luxS S-ribosylhomocysteine lyase Leuconostoc citreum (strain KM20)
Q5FK48 9.61e-35 122 37 2 168 3 luxS S-ribosylhomocysteine lyase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q1WT73 1.54e-34 121 40 2 147 3 luxS S-ribosylhomocysteine lyase Ligilactobacillus salivarius (strain UCC118)
Q03V83 4.99e-34 120 42 4 150 3 luxS S-ribosylhomocysteine lyase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B2G970 5.32e-34 120 39 1 151 3 luxS S-ribosylhomocysteine lyase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLV3 5.32e-34 120 39 1 151 3 luxS S-ribosylhomocysteine lyase Limosilactobacillus reuteri (strain DSM 20016)
Q1GC51 5.53e-34 120 37 1 163 3 luxS S-ribosylhomocysteine lyase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q04CP9 5.53e-34 120 37 1 163 3 luxS1 S-ribosylhomocysteine lyase 1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
B2GE54 6.26e-34 120 39 1 151 3 luxS S-ribosylhomocysteine lyase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
C1CPL5 9.59e-34 119 37 2 166 3 luxS S-ribosylhomocysteine lyase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIK5 9.59e-34 119 37 2 166 3 luxS S-ribosylhomocysteine lyase Streptococcus pneumoniae (strain P1031)
P65335 9.59e-34 119 37 2 166 3 luxS S-ribosylhomocysteine lyase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P65334 9.59e-34 119 37 2 166 3 luxS S-ribosylhomocysteine lyase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B1I959 9.59e-34 119 37 2 166 3 luxS S-ribosylhomocysteine lyase Streptococcus pneumoniae (strain Hungary19A-6)
C1CBB9 9.59e-34 119 37 2 166 3 luxS S-ribosylhomocysteine lyase Streptococcus pneumoniae (strain 70585)
B5E784 9.59e-34 119 37 2 166 3 luxS S-ribosylhomocysteine lyase Streptococcus pneumoniae serotype 19F (strain G54)
Q04MC2 9.59e-34 119 37 2 166 3 luxS S-ribosylhomocysteine lyase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A3CPX9 1.72e-33 119 37 2 166 3 luxS S-ribosylhomocysteine lyase Streptococcus sanguinis (strain SK36)
Q049W0 2.21e-33 119 40 3 154 3 luxS2 S-ribosylhomocysteine lyase 2 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
A8YXQ1 2.44e-33 118 39 1 151 3 luxS S-ribosylhomocysteine lyase Lactobacillus helveticus (strain DPC 4571)
C1CCB3 3.03e-33 118 36 2 166 3 luxS S-ribosylhomocysteine lyase Streptococcus pneumoniae (strain JJA)
B2ISQ8 3.03e-33 118 36 2 166 3 luxS S-ribosylhomocysteine lyase Streptococcus pneumoniae (strain CGSP14)
B8ZL57 3.03e-33 118 36 2 166 3 luxS S-ribosylhomocysteine lyase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q5QHW1 4.27e-33 118 38 1 151 3 luxS S-ribosylhomocysteine lyase Limosilactobacillus reuteri
Q8KQK6 1.87e-32 116 38 1 152 3 luxS S-ribosylhomocysteine lyase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q04DQ5 2e-32 116 42 3 152 3 luxS S-ribosylhomocysteine lyase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q6AAL4 4.1e-32 115 40 2 144 3 luxS S-ribosylhomocysteine lyase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q03TG6 1.12e-31 114 38 1 151 3 luxS S-ribosylhomocysteine lyase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B7GUC1 1.64e-31 114 39 1 150 3 luxS S-ribosylhomocysteine lyase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
B9DMC0 1.68e-31 114 39 2 146 3 luxS S-ribosylhomocysteine lyase Staphylococcus carnosus (strain TM300)
P65333 1.78e-31 114 38 1 152 3 luxS S-ribosylhomocysteine lyase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P65332 1.78e-31 114 38 1 152 3 luxS S-ribosylhomocysteine lyase Streptococcus agalactiae serotype III (strain NEM316)
Q3K375 1.78e-31 114 38 1 152 3 luxS S-ribosylhomocysteine lyase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8G568 1.79e-31 114 40 1 150 3 luxS S-ribosylhomocysteine lyase Bifidobacterium longum (strain NCC 2705)
Q03B21 3.35e-31 113 39 1 151 3 luxS S-ribosylhomocysteine lyase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WC53 3.35e-31 113 39 1 151 3 luxS S-ribosylhomocysteine lyase Lacticaseibacillus casei (strain BL23)
A4VTE8 4.19e-31 113 37 1 151 3 luxS S-ribosylhomocysteine lyase Streptococcus suis (strain 05ZYH33)
A4VZM6 4.19e-31 113 37 1 151 3 luxS S-ribosylhomocysteine lyase Streptococcus suis (strain 98HAH33)
Q8DVK8 4.88e-31 112 36 2 165 3 luxS S-ribosylhomocysteine lyase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q03M44 5.62e-31 112 39 1 148 3 luxS S-ribosylhomocysteine lyase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M5R0 5.62e-31 112 39 1 148 3 luxS S-ribosylhomocysteine lyase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M173 5.62e-31 112 39 1 148 3 luxS S-ribosylhomocysteine lyase Streptococcus thermophilus (strain CNRZ 1066)
B3DT87 5.82e-31 112 38 1 150 3 luxS S-ribosylhomocysteine lyase Bifidobacterium longum (strain DJO10A)
B2UWX8 6.45e-31 112 38 2 154 3 luxS S-ribosylhomocysteine lyase Clostridium botulinum (strain Alaska E43 / Type E3)
Q4L815 6.88e-31 112 39 2 146 3 luxS S-ribosylhomocysteine lyase Staphylococcus haemolyticus (strain JCSC1435)
B5XMJ4 1.09e-30 112 38 1 149 3 luxS S-ribosylhomocysteine lyase Streptococcus pyogenes serotype M49 (strain NZ131)
P0C0C7 1.09e-30 112 38 1 149 3 luxS S-ribosylhomocysteine lyase Streptococcus pyogenes
P0DC27 1.09e-30 112 38 1 149 3 luxS S-ribosylhomocysteine lyase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48S10 1.09e-30 112 38 1 149 3 luxS S-ribosylhomocysteine lyase Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RD59 1.09e-30 112 38 1 149 3 luxS S-ribosylhomocysteine lyase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JKN7 1.09e-30 112 38 1 149 3 luxS S-ribosylhomocysteine lyase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JAI5 1.09e-30 112 38 1 149 3 luxS S-ribosylhomocysteine lyase Streptococcus pyogenes serotype M12 (strain MGAS2096)
P0A3P9 1.09e-30 112 38 1 149 3 luxS S-ribosylhomocysteine lyase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XAN3 1.09e-30 112 38 1 149 3 luxS S-ribosylhomocysteine lyase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DC26 1.09e-30 112 38 1 149 3 luxS S-ribosylhomocysteine lyase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0C0C8 1.09e-30 112 38 1 149 3 luxS S-ribosylhomocysteine lyase Streptococcus pyogenes serotype M1
Q181K1 1.64e-30 111 37 2 154 3 luxS S-ribosylhomocysteine lyase Clostridioides difficile (strain 630)
Q1JFM8 2.61e-30 111 38 1 149 3 luxS S-ribosylhomocysteine lyase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q8CNI0 3.34e-30 110 38 2 151 3 luxS S-ribosylhomocysteine lyase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM88 3.34e-30 110 38 2 151 3 luxS S-ribosylhomocysteine lyase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q1J5H8 3.65e-30 110 38 1 149 3 luxS S-ribosylhomocysteine lyase Streptococcus pyogenes serotype M4 (strain MGAS10750)
B8DG43 3.78e-30 110 39 2 146 3 luxS S-ribosylhomocysteine lyase Listeria monocytogenes serotype 4a (strain HCC23)
B9DV56 5.22e-30 110 37 1 149 3 luxS S-ribosylhomocysteine lyase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q2YUL9 7.45e-30 109 39 2 146 3 luxS S-ribosylhomocysteine lyase Staphylococcus aureus (strain bovine RF122 / ET3-1)
P65331 8.76e-30 109 39 2 146 3 luxS S-ribosylhomocysteine lyase Staphylococcus aureus (strain MW2)
A8YYA0 8.76e-30 109 39 2 146 3 luxS S-ribosylhomocysteine lyase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G7H6 8.76e-30 109 39 2 146 3 luxS S-ribosylhomocysteine lyase Staphylococcus aureus (strain MSSA476)
Q6GEU1 8.76e-30 109 39 2 146 3 luxS S-ribosylhomocysteine lyase Staphylococcus aureus (strain MRSA252)
P65330 8.76e-30 109 39 2 146 1 luxS S-ribosylhomocysteine lyase Staphylococcus aureus (strain N315)
P65329 8.76e-30 109 39 2 146 3 luxS S-ribosylhomocysteine lyase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QIX8 8.76e-30 109 39 2 146 3 luxS S-ribosylhomocysteine lyase Staphylococcus aureus (strain Newman)
Q5HE66 8.76e-30 109 39 2 146 3 luxS S-ribosylhomocysteine lyase Staphylococcus aureus (strain COL)
A5IUS9 8.76e-30 109 39 2 146 3 luxS S-ribosylhomocysteine lyase Staphylococcus aureus (strain JH9)
Q2FWC3 8.76e-30 109 39 2 146 3 luxS S-ribosylhomocysteine lyase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEZ4 8.76e-30 109 39 2 146 3 luxS S-ribosylhomocysteine lyase Staphylococcus aureus (strain USA300)
A6U3L9 8.76e-30 109 39 2 146 3 luxS S-ribosylhomocysteine lyase Staphylococcus aureus (strain JH1)
A7X4Y8 8.76e-30 109 39 2 146 3 luxS S-ribosylhomocysteine lyase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q836D3 8.93e-30 109 39 4 161 3 luxS S-ribosylhomocysteine lyase Enterococcus faecalis (strain ATCC 700802 / V583)
Q88YI6 1.14e-29 109 37 1 151 3 luxS S-ribosylhomocysteine lyase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q1QVV8 1.19e-29 109 38 2 152 3 luxS S-ribosylhomocysteine lyase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1CV50 1.51e-29 108 36 2 146 3 luxS S-ribosylhomocysteine lyase Helicobacter pylori (strain HPAG1)
Q49Z80 1.54e-29 108 39 2 146 3 luxS S-ribosylhomocysteine lyase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A1A0P1 1.58e-29 108 38 1 150 3 luxS S-ribosylhomocysteine lyase Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
C5D6T8 2.75e-29 108 36 2 151 3 luxS S-ribosylhomocysteine lyase Geobacillus sp. (strain WCH70)
Q9ZMW8 3.2e-29 108 36 2 146 1 luxS S-ribosylhomocysteine lyase Helicobacter pylori (strain J99 / ATCC 700824)
C0MH25 3.49e-29 108 36 1 149 3 luxS S-ribosylhomocysteine lyase Streptococcus equi subsp. zooepidemicus (strain H70)
C0M785 4.01e-29 108 36 1 149 3 luxS S-ribosylhomocysteine lyase Streptococcus equi subsp. equi (strain 4047)
B6JPK6 4.71e-29 107 36 2 146 3 luxS S-ribosylhomocysteine lyase Helicobacter pylori (strain P12)
O34667 6.96e-29 107 35 2 151 1 luxS S-ribosylhomocysteine lyase Bacillus subtilis (strain 168)
B5Z9N6 2.75e-28 105 35 2 146 3 luxS S-ribosylhomocysteine lyase Helicobacter pylori (strain G27)
Q92C64 3.64e-28 105 38 2 146 3 luxS S-ribosylhomocysteine lyase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q17VY9 4.23e-28 105 36 2 146 3 luxS S-ribosylhomocysteine lyase Helicobacter acinonychis (strain Sheeba)
Q5KVY8 5.12e-28 105 36 2 148 3 luxS S-ribosylhomocysteine lyase Geobacillus kaustophilus (strain HTA426)
A8FGJ6 6.31e-28 104 36 2 151 3 luxS S-ribosylhomocysteine lyase Bacillus pumilus (strain SAFR-032)
Q9CIU0 6.92e-28 104 34 2 155 3 luxS S-ribosylhomocysteine lyase Lactococcus lactis subsp. lactis (strain IL1403)
O24931 9.73e-28 104 35 2 146 3 luxS S-ribosylhomocysteine lyase Helicobacter pylori (strain ATCC 700392 / 26695)
A2RHY8 1.3e-27 103 34 2 155 3 luxS S-ribosylhomocysteine lyase Lactococcus lactis subsp. cremoris (strain MG1363)
B2URT5 1.42e-27 103 35 2 146 3 luxS S-ribosylhomocysteine lyase Helicobacter pylori (strain Shi470)
Q032J0 1.51e-27 103 34 2 155 3 luxS S-ribosylhomocysteine lyase Lactococcus lactis subsp. cremoris (strain SK11)
B9E8I0 1.6e-27 103 39 2 146 3 luxS S-ribosylhomocysteine lyase Macrococcus caseolyticus (strain JCSC5402)
I0JJR3 1.87e-27 103 35 2 146 1 luxS S-ribosylhomocysteine lyase Halobacillus halophilus (strain ATCC 35676 / DSM 2266 / JCM 20832 / KCTC 3685 / LMG 17431 / NBRC 102448 / NCIMB 2269)
Q720D3 1.92e-27 103 37 2 146 3 luxS S-ribosylhomocysteine lyase Listeria monocytogenes serotype 4b (strain F2365)
C1L2J6 1.92e-27 103 37 2 146 3 luxS S-ribosylhomocysteine lyase Listeria monocytogenes serotype 4b (strain CLIP80459)
A5EVY3 1.95e-27 103 39 2 142 3 luxS S-ribosylhomocysteine lyase Dichelobacter nodosus (strain VCS1703A)
Q8Y7I9 2.8e-27 103 37 2 146 3 luxS S-ribosylhomocysteine lyase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B1YKZ3 3.11e-27 103 36 3 144 3 luxS S-ribosylhomocysteine lyase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A4IS03 3.61e-27 103 36 2 142 3 luxS S-ribosylhomocysteine lyase Geobacillus thermodenitrificans (strain NG80-2)
A0AI91 5.36e-27 102 37 2 146 3 luxS S-ribosylhomocysteine lyase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A7Z800 1.24e-26 101 35 2 151 3 luxS S-ribosylhomocysteine lyase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A9VLF6 1.46e-26 101 34 3 170 3 luxS S-ribosylhomocysteine lyase Bacillus mycoides (strain KBAB4)
Q816N5 1.46e-26 101 34 3 170 3 luxS S-ribosylhomocysteine lyase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7H9G6 1.46e-26 101 34 3 170 3 luxS S-ribosylhomocysteine lyase Bacillus cereus (strain B4264)
B7ILV4 1.46e-26 101 34 3 170 3 luxS S-ribosylhomocysteine lyase Bacillus cereus (strain G9842)
C1EW66 1.87e-26 101 34 3 170 3 luxS S-ribosylhomocysteine lyase Bacillus cereus (strain 03BB102)
Q6HC89 2.23e-26 100 34 3 170 3 luxS S-ribosylhomocysteine lyase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q632P8 2.23e-26 100 34 3 170 3 luxS S-ribosylhomocysteine lyase Bacillus cereus (strain ZK / E33L)
B9J289 2.23e-26 100 34 3 170 3 luxS S-ribosylhomocysteine lyase Bacillus cereus (strain Q1)
B7HTQ2 2.23e-26 100 34 3 170 3 luxS S-ribosylhomocysteine lyase Bacillus cereus (strain AH187)
Q72YS4 2.23e-26 100 34 3 170 3 luxS S-ribosylhomocysteine lyase Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JT57 2.23e-26 100 34 3 170 3 luxS S-ribosylhomocysteine lyase Bacillus cereus (strain AH820)
Q81KF3 2.23e-26 100 34 3 170 3 luxS S-ribosylhomocysteine lyase Bacillus anthracis
A0RK18 2.23e-26 100 34 3 170 3 luxS S-ribosylhomocysteine lyase Bacillus thuringiensis (strain Al Hakam)
C3LB27 2.23e-26 100 34 3 170 3 luxS S-ribosylhomocysteine lyase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PCE7 2.23e-26 100 34 3 170 3 luxS S-ribosylhomocysteine lyase Bacillus anthracis (strain A0248)
A7GU63 4.17e-26 100 35 2 151 3 luxS S-ribosylhomocysteine lyase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q65FU5 5.95e-26 99 35 3 160 3 luxS S-ribosylhomocysteine lyase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8CUK0 1.44e-25 98 36 2 144 3 luxS S-ribosylhomocysteine lyase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5WDW1 7.55e-24 94 33 2 151 3 luxS S-ribosylhomocysteine lyase Shouchella clausii (strain KSM-K16)
Q9K7K8 2.09e-23 93 34 2 143 3 luxS S-ribosylhomocysteine lyase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B0S194 1.19e-16 75 32 5 140 3 luxS S-ribosylhomocysteine lyase Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
C6BU86 9.1e-16 73 33 5 140 3 luxS S-ribosylhomocysteine lyase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q0SND6 1.58e-14 70 30 6 160 3 luxS S-ribosylhomocysteine lyase Borreliella afzelii (strain PKo)
Q6AQW6 2.02e-14 70 32 5 144 3 luxS S-ribosylhomocysteine lyase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B7J1U9 2.06e-14 70 31 7 163 3 luxS S-ribosylhomocysteine lyase Borreliella burgdorferi (strain ZS7)
O50164 2.06e-14 70 31 7 163 3 luxS S-ribosylhomocysteine lyase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q661P2 2.62e-14 69 31 7 163 3 luxS S-ribosylhomocysteine lyase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q97F13 1.26e-13 67 33 6 148 3 luxS S-ribosylhomocysteine lyase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A6KYS6 1.26e-12 65 30 5 140 3 luxS S-ribosylhomocysteine lyase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A6LST9 1.43e-10 59 31 8 158 3 luxS S-ribosylhomocysteine lyase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q7MWT9 1.83e-09 57 28 5 164 3 luxS S-ribosylhomocysteine lyase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RKU8 1.92e-09 57 28 5 164 3 luxS S-ribosylhomocysteine lyase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_09775
Feature type CDS
Gene luxS
Product S-ribosylhomocysteine lyase
Location 18515 - 19030 (strand: -1)
Length 516 (nucleotides) / 171 (amino acids)
In genomic island -

Contig

Accession ZDB_687
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2077
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02664 S-Ribosylhomocysteinase (LuxS)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1854 Signal transduction mechanisms (T) T S-ribosylhomocysteine lyase LuxS, autoinducer biosynthesis

Kegg Ortholog Annotation(s)

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG018243 S-ribosylhomocysteinase VF0406 Biofilm

Protein Sequence

MPLLDSFLVDHTRMAAPAVRVAKTMTTPGGDTITVFDLRFCVPNEEILPERGTHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGAPSETRVAQAWKDAMADILTVKDQAKIPELNLYQCGTYKMHSLEEAHQIAKNIIERDVRVNKNDELLLSDDELEKLHP

Flanking regions ( +/- flanking 50bp)

AAAGTTTCATTCGTTCGGCATTTTTTACAAAAAAAAGAGGAGCGGGAATTATGCCTTTGCTGGATAGTTTTTTAGTTGACCACACACGCATGGCGGCACCTGCGGTACGCGTAGCGAAAACCATGACCACCCCGGGTGGCGATACCATCACTGTTTTCGATCTGCGTTTTTGTGTTCCTAATGAAGAGATTCTGCCGGAAAGAGGAACGCATACACTGGAACACCTGTTTGCCGGTTTTATGCGTAACCATTTAAACGGCAATGGTGTTGAAATCATTGATATCTCGCCGATGGGCTGCCGTACCGGGTTCTATATGAGCCTGATTGGTGCGCCGTCAGAAACCCGTGTTGCACAGGCCTGGAAAGACGCTATGGCGGATATCCTGACTGTCAAAGATCAGGCGAAGATCCCTGAACTGAACCTGTATCAGTGCGGGACGTATAAAATGCATTCACTGGAAGAAGCACATCAGATTGCAAAAAACATCATTGAGCGCGATGTTCGCGTCAACAAAAATGATGAACTGCTGTTATCTGATGATGAGCTGGAAAAACTGCATCCGTAATTTTTCAGCCCCGGATACAAAAAAACCTGCGCGCATTGCTGTCGCAGGTT