Homologs in group_153

Help

9 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07560 FBDBKF_07560 100.0 Morganella morganii S1 eutM ethanolamine utilization microcompartment protein EutM
EHELCC_17230 EHELCC_17230 100.0 Morganella morganii S2 eutM ethanolamine utilization microcompartment protein EutM
NLDBIP_13835 NLDBIP_13835 100.0 Morganella morganii S4 eutM ethanolamine utilization microcompartment protein EutM
LHKJJB_09015 LHKJJB_09015 100.0 Morganella morganii S3 eutM ethanolamine utilization microcompartment protein EutM
F4V73_RS13560 F4V73_RS13560 97.9 Morganella psychrotolerans eutM ethanolamine utilization microcompartment protein EutM
PMI_RS13375 PMI_RS13375 38.5 Proteus mirabilis HI4320 - BMC domain-containing protein
PMI_RS13405 PMI_RS13405 57.1 Proteus mirabilis HI4320 - BMC domain-containing protein
PMI_RS13410 PMI_RS13410 55.9 Proteus mirabilis HI4320 - BMC domain-containing protein
PMI_RS13415 PMI_RS13415 58.2 Proteus mirabilis HI4320 - BMC domain-containing protein

Distribution of the homologs in the orthogroup group_153

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_153

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P41791 1.48e-49 154 91 0 96 1 eutM Bacterial microcompartment shell protein EutM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0ABF4 3.33e-49 154 92 0 95 1 eutM Bacterial microcompartment shell protein EutM Escherichia coli (strain K12)
P0ABF5 3.33e-49 154 92 0 95 3 eutM Bacterial microcompartment shell protein EutM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
D0LID5 5.02e-33 113 60 0 87 1 Hoch_5815 Bacterial microcompartment protein homohexamer Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2)
Q187N0 2.6e-31 108 73 0 86 1 eutM Bacterial microcompartment shell protein EutM Clostridioides difficile (strain 630)
P72761 1.64e-28 101 53 1 91 1 ccmK2 Carboxysome shell protein CcmK2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0DUM6 2.14e-28 101 68 0 86 1 pduA Bacterial microcompartment shell protein PduA Citrobacter freundii
P0A1C7 2.3e-28 101 68 0 86 1 pduA Bacterial microcompartment shell protein PduA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1C8 2.3e-28 101 68 0 86 3 pduA Bacterial microcompartment shell protein PduA Salmonella typhi
H9L478 2.87e-28 100 67 0 86 1 pduJ Bacterial microcompartment shell protein PduJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8DKB2 8.7e-28 100 53 1 91 1 ccmK2 Carboxysome shell protein CcmK2 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P0DUV5 1.57e-26 96 66 0 86 1 pduJ Bacterial microcompartment shell protein PduJ Citrobacter freundii
Q03511 1.61e-26 96 53 1 91 1 ccmK2 Carboxysome shell protein CcmK2 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O30709 1.27e-25 94 50 1 91 3 ccmK Carboxysome shell protein CcmK Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P72760 1.42e-25 94 51 1 91 1 ccmK1 Carboxysome shell protein CcmK1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8DKB3 1.66e-25 94 51 1 91 1 ccmK1 Carboxysome shell protein CcmK1 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P45688 4.39e-24 90 54 1 86 1 csoS1C Carboxysome shell protein CsoS1C Halothiobacillus neapolitanus (strain ATCC 23641 / c2)
P45689 4.59e-24 90 54 1 86 1 csoS1A Major carboxysome shell protein CsoS1A Halothiobacillus neapolitanus (strain ATCC 23641 / c2)
Q31HD1 7.19e-24 90 53 2 96 1 csoS1C Carboxysome shell protein CsoS1C Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P45690 7.61e-24 90 55 1 86 1 csoS1B Carboxysome shell protein CsoS1B Halothiobacillus neapolitanus (strain ATCC 23641 / c2)
Q31HD2 1.49e-23 89 53 1 88 3 csoS1B Carboxysome shell protein CsoS1B Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q31HD3 1.68e-23 89 53 1 88 1 csoS1A Carboxysome shell protein CsoS1A Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q7V2D1 1.98e-23 89 54 2 92 1 csoS1 Major carboxysome shell protein CsoS1 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
P0A330 3.27e-23 88 56 1 82 2 csoS1 Carboxysome shell protein CsoS1 Synechococcus sp. (strain WH7803)
P0A328 3.27e-23 88 56 1 82 3 csoS1 Carboxysome shell protein CsoS1 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
P0A329 3.27e-23 88 56 1 82 1 csoS1 Carboxysome shell protein CsoS1 Parasynechococcus marenigrum (strain WH8102)
Q7V6F7 3.3e-23 88 56 1 82 1 csoS1 Carboxysome shell protein CsoS1 Prochlorococcus marinus (strain MIT 9313)
Q7V6G4 4.02e-22 88 52 1 85 3 csoS1E Probable carboxysome shell protein CsoS1E Prochlorococcus marinus (strain MIT 9313)
P23656 3.92e-20 84 47 0 93 3 ccmO Carboxysome assembly protein CcmO Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P23656 8.7e-17 75 43 0 86 3 ccmO Carboxysome assembly protein CcmO Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P46205 3.92e-20 84 47 0 93 1 ccmO Carboxysome assembly protein CcmO Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P46205 8.7e-17 75 43 0 86 1 ccmO Carboxysome assembly protein CcmO Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q55121 1.32e-19 83 47 0 86 3 ccmO Carboxysome assembly protein CcmO Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q55121 2.11e-17 77 47 0 86 3 ccmO Carboxysome assembly protein CcmO Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q31RK2 1.24e-17 74 43 1 89 1 ccmK4 Carboxysome shell protein CcmK4 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
K9Y6N7 5.15e-16 70 41 1 95 1 ccmK4 Carboxysome shell protein CcmK4 Halothece sp. (strain PCC 7418)
P73407 4.27e-13 62 40 1 91 1 ccmK4 Carboxysome shell protein CcmK4 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P76540 4.25e-12 61 49 0 83 1 eutK Bacterial microcompartment shell protein EutK Escherichia coli (strain K12)
P73406 4.77e-08 49 31 1 93 1 ccmK3 Carboxysome shell protein CcmK3 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B1VB70 8.78e-08 50 39 1 78 1 pduK Bacterial microcompartment shell protein PduK Citrobacter freundii
Q9ZFU8 4.69e-07 48 49 0 83 1 eutK Bacterial microcompartment shell protein EutK Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9XDN6 5.91e-07 48 37 1 78 1 pduK Bacterial microcompartment shell protein PduK Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0DUV7 5.38e-06 45 41 2 80 1 pduT Bacterial microcompartment shell protein PduT Citrobacter freundii
P0DUV7 0.000116 42 35 3 96 1 pduT Bacterial microcompartment shell protein PduT Citrobacter freundii
K9Y7V9 5.87e-06 44 37 1 93 1 ccmK3 Carboxysome shell protein CcmK3 Halothece sp. (strain PCC 7418)
Q9XDM8 7.86e-06 45 40 2 80 1 pduT Bacterial microcompartment shell protein PduT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q31RK3 0.000166 40 37 1 94 1 ccmK3 Carboxysome shell protein CcmK3 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_08565
Feature type CDS
Gene eutM
Product ethanolamine utilization microcompartment protein EutM
Location 140610 - 140903 (strand: -1)
Length 294 (nucleotides) / 97 (amino acids)

Contig

Accession ZDB_685
Length 192328 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_153
Orthogroup size 10
N. genomes 7

Actions

Genomic region

Domains

PF00936 BMC domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4577 Secondary metabolites biosynthesis, transport and catabolism (Q)
Energy production and conversion (C)		 QC Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04027 ethanolamine utilization protein EutM - -

Protein Sequence

MEALGLIETKGLVALIEASDAMVKAARVKLVGVKQIGGGLVTAMVRGDVAACKAATDAGAAAAQRIGELVSVHVIPRPHGDLEEVFPIKMSGDKSID

Flanking regions ( +/- flanking 50bp)

AGCGTTATTTAAACCGGTCCCTGATGGGATCTCAATGAGAGGAAAATATCATGGAAGCATTAGGACTGATCGAAACTAAGGGTCTGGTTGCATTAATCGAAGCATCCGATGCGATGGTCAAAGCAGCACGCGTTAAATTAGTCGGTGTTAAACAAATCGGCGGTGGTCTGGTAACAGCCATGGTGCGCGGTGATGTTGCAGCATGTAAAGCAGCGACTGACGCAGGCGCGGCAGCAGCTCAGCGTATCGGTGAACTGGTCTCTGTACACGTTATTCCTCGTCCGCATGGCGATCTGGAAGAAGTGTTTCCTATCAAAATGTCCGGCGATAAATCAATCGATTAATCGTTGTTAGCGTGGCGTGCTTCTGACGCCACGCGATTTTAATCTCCCCG