Homologs in group_153

Help

9 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07560 FBDBKF_07560 55.9 Morganella morganii S1 eutM ethanolamine utilization microcompartment protein EutM
EHELCC_17230 EHELCC_17230 55.9 Morganella morganii S2 eutM ethanolamine utilization microcompartment protein EutM
NLDBIP_13835 NLDBIP_13835 55.9 Morganella morganii S4 eutM ethanolamine utilization microcompartment protein EutM
LHKJJB_09015 LHKJJB_09015 55.9 Morganella morganii S3 eutM ethanolamine utilization microcompartment protein EutM
HKOGLL_08565 HKOGLL_08565 55.9 Morganella morganii S5 eutM ethanolamine utilization microcompartment protein EutM
F4V73_RS13560 F4V73_RS13560 55.9 Morganella psychrotolerans eutM ethanolamine utilization microcompartment protein EutM
PMI_RS13375 PMI_RS13375 46.7 Proteus mirabilis HI4320 - BMC domain-containing protein
PMI_RS13405 PMI_RS13405 83.7 Proteus mirabilis HI4320 - BMC domain-containing protein
PMI_RS13415 PMI_RS13415 90.2 Proteus mirabilis HI4320 - BMC domain-containing protein

Distribution of the homologs in the orthogroup group_153

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_153

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
D0LID5 7.14e-29 102 62 0 83 1 Hoch_5815 Bacterial microcompartment protein homohexamer Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2)
H9L478 2.47e-28 100 64 0 89 1 pduJ Bacterial microcompartment shell protein PduJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0DUM6 3.14e-27 98 62 0 87 1 pduA Bacterial microcompartment shell protein PduA Citrobacter freundii
P0A1C7 3.26e-27 98 62 0 87 1 pduA Bacterial microcompartment shell protein PduA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1C8 3.26e-27 98 62 0 87 3 pduA Bacterial microcompartment shell protein PduA Salmonella typhi
P72761 1.48e-26 96 51 1 89 1 ccmK2 Carboxysome shell protein CcmK2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0DUV5 1.48e-26 96 62 0 89 1 pduJ Bacterial microcompartment shell protein PduJ Citrobacter freundii
Q187N0 1.97e-26 96 62 0 87 1 eutM Bacterial microcompartment shell protein EutM Clostridioides difficile (strain 630)
Q03511 2.34e-25 93 51 1 89 1 ccmK2 Carboxysome shell protein CcmK2 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8DKB2 3.07e-25 93 50 1 89 1 ccmK2 Carboxysome shell protein CcmK2 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q7V6F7 3.26e-25 93 58 1 86 1 csoS1 Carboxysome shell protein CsoS1 Prochlorococcus marinus (strain MIT 9313)
Q7V2D1 3.56e-25 93 58 1 86 1 csoS1 Major carboxysome shell protein CsoS1 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
P0A330 3.97e-25 93 58 1 86 2 csoS1 Carboxysome shell protein CsoS1 Synechococcus sp. (strain WH7803)
P0A328 3.97e-25 93 58 1 86 3 csoS1 Carboxysome shell protein CsoS1 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
P0A329 3.97e-25 93 58 1 86 1 csoS1 Carboxysome shell protein CsoS1 Parasynechococcus marenigrum (strain WH8102)
Q31HD1 2.74e-24 90 54 1 88 1 csoS1C Carboxysome shell protein CsoS1C Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q31HD2 2.9e-24 90 52 1 91 3 csoS1B Carboxysome shell protein CsoS1B Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q8DKB3 3.66e-24 90 50 1 90 1 ccmK1 Carboxysome shell protein CcmK1 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P72760 3.83e-24 90 48 1 90 1 ccmK1 Carboxysome shell protein CcmK1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P41791 4.47e-24 90 59 0 84 1 eutM Bacterial microcompartment shell protein EutM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0ABF4 5.18e-24 90 59 0 84 1 eutM Bacterial microcompartment shell protein EutM Escherichia coli (strain K12)
P0ABF5 5.18e-24 90 59 0 84 3 eutM Bacterial microcompartment shell protein EutM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q31HD3 8.89e-24 89 54 1 87 1 csoS1A Carboxysome shell protein CsoS1A Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q7V6G4 2.29e-23 91 57 1 84 3 csoS1E Probable carboxysome shell protein CsoS1E Prochlorococcus marinus (strain MIT 9313)
O30709 3e-23 88 47 1 90 3 ccmK Carboxysome shell protein CcmK Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P45688 8.55e-23 87 52 1 89 1 csoS1C Carboxysome shell protein CsoS1C Halothiobacillus neapolitanus (strain ATCC 23641 / c2)
P45689 1.11e-22 86 52 1 89 1 csoS1A Major carboxysome shell protein CsoS1A Halothiobacillus neapolitanus (strain ATCC 23641 / c2)
P45690 1.86e-22 86 53 1 89 1 csoS1B Carboxysome shell protein CsoS1B Halothiobacillus neapolitanus (strain ATCC 23641 / c2)
P23656 6.03e-20 84 53 0 80 3 ccmO Carboxysome assembly protein CcmO Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P23656 1.97e-13 66 36 0 85 3 ccmO Carboxysome assembly protein CcmO Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P46205 6.03e-20 84 53 0 80 1 ccmO Carboxysome assembly protein CcmO Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P46205 1.97e-13 66 36 0 85 1 ccmO Carboxysome assembly protein CcmO Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q55121 4.23e-17 76 41 0 86 3 ccmO Carboxysome assembly protein CcmO Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q55121 3.27e-15 71 40 1 93 3 ccmO Carboxysome assembly protein CcmO Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q31RK2 1.76e-16 71 36 2 100 1 ccmK4 Carboxysome shell protein CcmK4 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P76540 3.35e-16 72 47 0 90 1 eutK Bacterial microcompartment shell protein EutK Escherichia coli (strain K12)
K9Y6N7 4.09e-15 68 39 1 84 1 ccmK4 Carboxysome shell protein CcmK4 Halothece sp. (strain PCC 7418)
P73407 1.22e-12 61 40 1 82 1 ccmK4 Carboxysome shell protein CcmK4 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B1VB70 1.16e-10 57 40 1 84 1 pduK Bacterial microcompartment shell protein PduK Citrobacter freundii
Q9ZFU8 4.24e-09 53 45 0 90 1 eutK Bacterial microcompartment shell protein EutK Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9XDN6 4.62e-09 53 40 1 77 1 pduK Bacterial microcompartment shell protein PduK Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9XDM8 1.64e-07 49 33 1 83 1 pduT Bacterial microcompartment shell protein PduT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9XDM8 5.16e-06 45 37 2 85 1 pduT Bacterial microcompartment shell protein PduT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0DUV7 9.48e-07 47 36 1 83 1 pduT Bacterial microcompartment shell protein PduT Citrobacter freundii
P0DUV7 2.25e-06 46 38 2 85 1 pduT Bacterial microcompartment shell protein PduT Citrobacter freundii
P73406 1.19e-05 43 29 1 86 1 ccmK3 Carboxysome shell protein CcmK3 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
K9Y7V9 3.98e-05 42 33 1 90 1 ccmK3 Carboxysome shell protein CcmK3 Halothece sp. (strain PCC 7418)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13410
Feature type CDS
Gene -
Product BMC domain-containing protein
Location 2972235 - 2972519 (strand: -1)
Length 285 (nucleotides) / 94 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_153
Orthogroup size 10
N. genomes 7

Actions

Genomic region

Domains

PF00936 BMC domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4577 Secondary metabolites biosynthesis, transport and catabolism (Q)
Energy production and conversion (C)		 QC Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04027 ethanolamine utilization protein EutM - -

Protein Sequence

MGDALGLIETQGLVACIEAADAMCKAANVELIGYENVGSGLVTAMVKGDVGAVKAAVDSGLEAAQRVGTVVTSLVIARPHNDIQKIVAQYKVTE

Flanking regions ( +/- flanking 50bp)

AACAAAATTGTTATCAAACACAAGGCATAGTCTTTGCCTTAGGAGAACGTATGGGTGATGCATTAGGACTTATTGAAACTCAAGGGCTAGTGGCATGTATTGAAGCCGCTGATGCGATGTGCAAAGCCGCCAATGTTGAATTGATTGGTTATGAAAATGTTGGCTCAGGTTTGGTCACTGCAATGGTAAAAGGCGATGTGGGTGCCGTTAAAGCCGCTGTAGATTCTGGCTTAGAAGCGGCTCAACGTGTAGGTACGGTGGTCACTTCATTAGTCATCGCTCGTCCACATAACGATATTCAAAAAATCGTTGCCCAGTACAAAGTGACTGAATAACGAAGGAAATAAATATGAAAGAAGCACTCGGTCTAGTGGAAACCAAAGGT