Homologs in group_404

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13315 FBDBKF_13315 100.0 Morganella morganii S1 fepC heme ABC transporter ATP-binding protein
EHELCC_08780 EHELCC_08780 100.0 Morganella morganii S2 fepC heme ABC transporter ATP-binding protein
NLDBIP_09105 NLDBIP_09105 100.0 Morganella morganii S4 fepC heme ABC transporter ATP-binding protein
LHKJJB_05160 LHKJJB_05160 100.0 Morganella morganii S3 fepC heme ABC transporter ATP-binding protein
F4V73_RS03440 F4V73_RS03440 61.5 Morganella psychrotolerans - heme ABC transporter ATP-binding protein
PMI_RS06920 PMI_RS06920 42.2 Proteus mirabilis HI4320 - heme ABC transporter ATP-binding protein

Distribution of the homologs in the orthogroup group_404

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_404

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q6D645 8.7e-75 231 49 2 245 3 hmuV Hemin import ATP-binding protein HmuV Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7N3S7 2.77e-73 228 47 1 253 3 hmuV Hemin import ATP-binding protein HmuV Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1R597 2.5e-70 219 45 1 245 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli (strain UTI89 / UPEC)
Q8X5N2 3.21e-70 219 46 1 245 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O157:H7
Q8FCJ1 3.94e-70 219 45 1 245 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBU8 3.94e-70 219 45 1 245 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q32AY3 1.19e-69 218 45 1 245 3 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae serotype 1 (strain Sd197)
O70014 2.03e-69 217 45 1 245 1 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae
Q66FK0 1.58e-66 210 45 1 251 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CE65 1.58e-66 210 45 1 251 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Nepal516)
Q56993 1.58e-66 210 45 1 251 1 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis
Q1C0Q8 1.58e-66 210 45 1 251 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Antiqua)
Q84EY8 9.11e-65 206 46 1 237 3 hmuV Hemin import ATP-binding protein HmuV Enterobacter cloacae
P74981 5.11e-64 204 46 1 245 1 hmuV Hemin import ATP-binding protein HmuV Yersinia enterocolitica
Q2NSR0 7.15e-63 201 47 1 239 3 hmuV Hemin import ATP-binding protein HmuV Sodalis glossinidius (strain morsitans)
Q31J97 1.9e-51 171 38 2 249 3 hmuV Hemin import ATP-binding protein HmuV Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q12R52 4.71e-49 165 39 3 235 3 hmuV Hemin import ATP-binding protein HmuV Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q5QXD0 1.44e-48 164 40 5 245 3 hmuV Hemin import ATP-binding protein HmuV Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q93SS1 2.81e-48 163 37 5 260 3 hmuV Hemin import ATP-binding protein HmuV Plesiomonas shigelloides
Q87J32 2.1e-47 161 37 3 247 3 hmuV Hemin import ATP-binding protein HmuV Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q2SB47 3.21e-47 160 36 4 256 3 hmuV Hemin import ATP-binding protein HmuV Hahella chejuensis (strain KCTC 2396)
Q07LU3 1.72e-46 159 39 4 241 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisA53)
Q217B2 5.33e-46 158 37 3 242 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB18)
Q5E5I1 6.24e-46 157 36 6 258 3 hmuV Hemin import ATP-binding protein HmuV Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q138A9 1.87e-45 156 38 5 254 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB5)
Q92N13 2.65e-45 156 38 6 242 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium meliloti (strain 1021)
Q3SQ65 2.68e-44 153 38 5 243 3 hmuV Hemin import ATP-binding protein HmuV Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q0SIB7 5.09e-44 153 37 4 272 3 hmuV Hemin import ATP-binding protein HmuV Rhodococcus jostii (strain RHA1)
Q7MFA1 5.21e-44 152 35 3 251 3 hmuV Hemin import ATP-binding protein HmuV Vibrio vulnificus (strain YJ016)
Q70YG7 1.76e-43 151 35 3 244 1 hmuV Hemin import ATP-binding protein HmuV Vibrio anguillarum (strain ATCC 68554 / 775)
Q2RZ08 2.16e-43 151 39 5 238 3 hmuV Hemin import ATP-binding protein HmuV Salinibacter ruber (strain DSM 13855 / M31)
Q8D3S8 2.52e-43 150 35 3 254 3 hmuV Hemin import ATP-binding protein HmuV Vibrio vulnificus (strain CMCP6)
Q2J3T0 3.93e-43 150 36 6 256 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain HaA2)
Q6LQC0 4.05e-43 150 36 8 261 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium profundum (strain SS9)
Q4K5Z7 4.85e-43 150 39 5 256 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q93SH7 5.3e-43 150 36 3 243 3 hmuV Hemin import ATP-binding protein HmuV Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q11ID5 7.06e-43 149 38 7 241 3 hmuV Hemin import ATP-binding protein HmuV Chelativorans sp. (strain BNC1)
Q659V4 8.73e-43 149 35 6 262 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damselae subsp. damselae
Q6N7Y6 9.55e-43 149 38 3 253 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q70GD4 1.37e-42 149 35 6 262 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damsela subsp. piscicida
Q1LC89 3.48e-42 148 37 3 251 3 hmuV Hemin import ATP-binding protein HmuV Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q8EB59 8.13e-42 146 37 4 235 3 hmuV Hemin import ATP-binding protein HmuV Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q88DY1 1.32e-41 146 37 5 256 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2K551 2.11e-41 145 35 6 248 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q28QF9 2.52e-41 145 37 6 238 3 hmuV Hemin import ATP-binding protein HmuV Jannaschia sp. (strain CCS1)
Q9RKQ4 2.99e-41 146 38 3 240 3 hmuV Hemin import ATP-binding protein HmuV Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q7NN36 4.89e-41 145 36 5 257 3 hmuV Hemin import ATP-binding protein HmuV Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q1MCZ1 5.02e-41 145 34 7 257 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1GJU0 5.04e-41 145 34 4 252 3 hmuV Hemin import ATP-binding protein HmuV Ruegeria sp. (strain TM1040)
Q47MA5 1.28e-40 144 36 3 257 3 hmuV Hemin import ATP-binding protein HmuV Thermobifida fusca (strain YX)
Q3K6R9 3.03e-40 142 36 4 252 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain Pf0-1)
Q5YVL8 3.58e-40 143 38 5 262 3 hmuV Hemin import ATP-binding protein HmuV Nocardia farcinica (strain IFM 10152)
P94420 3.95e-40 142 32 4 236 1 yclP Petrobactin import ATP-binding protein YclP Bacillus subtilis (strain 168)
Q8L1U3 6.73e-40 142 33 2 257 1 hmuV Hemin import ATP-binding protein HmuV Bordetella avium
Q2KUC0 6.73e-40 142 33 2 257 3 hmuV Hemin import ATP-binding protein HmuV Bordetella avium (strain 197N)
Q98L75 1.02e-39 141 35 5 242 3 hmuV Hemin import ATP-binding protein HmuV Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q9KL34 1.24e-39 141 36 5 238 3 hmuV Hemin import ATP-binding protein HmuV Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q3ICT8 1.42e-39 141 33 5 257 3 hmuV Hemin import ATP-binding protein HmuV Pseudoalteromonas translucida (strain TAC 125)
P07821 2.78e-39 140 34 5 257 1 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Escherichia coli (strain K12)
Q8UCM5 1.07e-38 139 34 5 246 3 hmuV Hemin import ATP-binding protein HmuV Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9AE30 1.61e-38 138 36 7 221 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium leguminosarum
Q1I4Q5 2.18e-38 138 37 3 251 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas entomophila (strain L48)
O68877 2.35e-38 137 38 4 252 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02FW7 2.35e-38 137 38 4 252 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas aeruginosa (strain UCBPP-PA14)
Q1J255 3.26e-38 138 36 6 267 3 hmuV Hemin import ATP-binding protein HmuV Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q1H0W2 6.69e-38 137 35 1 240 3 hmuV Hemin import ATP-binding protein HmuV Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q6G475 2.62e-37 135 33 5 245 3 hmuV Hemin import ATP-binding protein HmuV Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q9RZU5 3.5e-37 135 36 7 258 3 hmuV Hemin import ATP-binding protein HmuV Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q6G098 5.36e-37 134 33 4 242 3 hmuV Hemin import ATP-binding protein HmuV Bartonella quintana (strain Toulouse)
Q2T3B8 1.2e-36 134 36 4 254 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q160G4 1.2e-36 133 33 5 239 3 hmuV Hemin import ATP-binding protein HmuV Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q63NR0 2.22e-36 133 36 3 252 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia pseudomallei (strain K96243)
Q3JHM1 2.22e-36 133 36 3 252 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia pseudomallei (strain 1710b)
Q62A98 2.22e-36 133 36 3 252 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia mallei (strain ATCC 23344)
Q1DCP5 2.51e-36 132 38 3 221 3 hmuV Hemin import ATP-binding protein HmuV Myxococcus xanthus (strain DK1622)
O34631 4.75e-36 136 33 3 262 3 yvrA Uncharacterized ABC transporter ATP-binding protein YvrA Bacillus subtilis (strain 168)
Q39B28 4.49e-35 129 35 3 253 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q7WEH6 6.24e-35 129 35 4 251 3 hmuV Hemin import ATP-binding protein HmuV Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q0B697 6.5e-35 129 36 4 253 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q7W359 8.14e-35 129 35 4 251 3 hmuV Hemin import ATP-binding protein HmuV Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7W025 1.13e-34 128 35 4 251 3 hmuV Hemin import ATP-binding protein HmuV Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q58283 1.98e-34 128 32 3 242 3 MJ0873 Uncharacterized ABC transporter ATP-binding protein MJ0873 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q1BJA5 1.54e-33 125 35 5 256 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia orbicola (strain AU 1054)
A0B3E2 1.54e-33 125 35 5 256 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia cenocepacia (strain HI2424)
P15031 1.11e-31 120 33 5 255 1 fecE Fe(3+) dicitrate transport ATP-binding protein FecE Escherichia coli (strain K12)
O86751 2.05e-30 119 36 7 254 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q4KC87 1.56e-29 117 32 5 251 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P21410 1.61e-29 117 33 3 209 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Serratia marcescens
Q9HQ18 6.2e-29 116 31 2 244 1 btuD Cobalamin import ATP-binding protein BtuD Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G4 6.2e-29 116 31 2 244 3 btuD Cobalamin import ATP-binding protein BtuD Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q6LQ77 1.46e-28 112 32 5 230 3 btuD Vitamin B12 import ATP-binding protein BtuD Photobacterium profundum (strain SS9)
O34510 9.57e-28 110 29 3 251 3 yfmF Fe(3+)-citrate import ATP-binding protein YfmF Bacillus subtilis (strain 168)
P49938 4.79e-27 108 28 2 254 3 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Bacillus subtilis (strain 168)
Q6D2F6 5.25e-27 110 33 3 218 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q0SBZ1 8.77e-27 109 33 6 229 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhodococcus jostii (strain RHA1)
Q0S0Z3 1.26e-26 109 34 5 223 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhodococcus jostii (strain RHA1)
Q48C94 1.34e-26 107 35 4 206 3 tauB Taurine import ATP-binding protein TauB Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
C3LLU1 1.71e-26 106 35 5 220 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio cholerae serotype O1 (strain M66-2)
Q9KSL1 1.71e-26 106 35 5 220 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q73P71 1.87e-26 106 28 5 251 3 phnC Phosphonates import ATP-binding protein PhnC Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q5L222 2.04e-26 108 29 7 257 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
Q3MAR5 2.31e-26 108 30 5 254 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8YM92 2.61e-26 108 30 5 254 3 potA Spermidine/putrescine import ATP-binding protein PotA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q47087 2.66e-26 106 27 3 251 3 cbrD Achromobactin transport ATP-binding protein CbrD Dickeya dadantii (strain 3937)
P23878 2.77e-26 106 28 3 254 1 fepC Ferric enterobactin transport ATP-binding protein FepC Escherichia coli (strain K12)
P14788 3.2e-26 108 34 4 211 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q4QP85 3.63e-26 108 31 4 227 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Haemophilus influenzae (strain 86-028NP)
A5F1V0 3.79e-26 105 35 5 220 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P44513 5.14e-26 107 31 4 227 1 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8RI39 5.14e-26 108 28 5 256 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q3KCC5 6.95e-26 107 31 3 219 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain Pf0-1)
Q6F0V4 1.06e-25 106 32 5 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q2JLH7 1.24e-25 105 32 6 237 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q5FA19 1.36e-25 106 33 3 221 1 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q81LM1 1.42e-25 104 28 4 232 1 fpuC Petrobactin import ATP-binding protein FpuC Bacillus anthracis
Q92AF9 1.77e-25 103 31 9 230 3 mntB Manganese transport system ATP-binding protein MntB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q0RYP7 1.94e-25 105 32 6 229 3 fbpC3 Fe(3+) ions import ATP-binding protein FbpC 3 Rhodococcus jostii (strain RHA1)
Q57554 1.98e-25 103 31 6 227 3 MJ0089 Uncharacterized ABC transporter ATP-binding protein MJ0089 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q98G43 2.14e-25 106 31 4 216 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q668Q3 2.95e-25 105 32 3 209 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pseudotuberculosis serotype I (strain IP32953)
P40416 2.97e-25 107 29 7 244 1 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q1CJS9 3.21e-25 105 32 3 209 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZCM2 3.21e-25 105 32 3 209 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis
Q1C607 3.21e-25 105 32 3 209 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis bv. Antiqua (strain Antiqua)
Q0BZD8 3.58e-25 103 31 5 247 3 phnC Phosphonates import ATP-binding protein PhnC Hyphomonas neptunium (strain ATCC 15444)
Q832R5 4.73e-25 107 29 7 241 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q832R5 1.28e-15 79 28 8 246 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
D5AQY6 4.85e-25 103 33 5 243 1 nikO Nickel import ATP-binding protein NikO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q81CT8 4.93e-25 107 31 7 231 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CT8 6.13e-12 68 24 8 259 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8X5I6 5.11e-25 102 34 6 224 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O157:H7
Q81XB3 5.5e-25 102 28 3 221 1 fatE Petrobactin import ATP-binding protein FatE Bacillus anthracis
Q325N3 5.79e-25 102 34 6 219 3 tauB Taurine import ATP-binding protein TauB Shigella boydii serotype 4 (strain Sb227)
Q3Z542 7.06e-25 102 33 6 224 3 tauB Taurine import ATP-binding protein TauB Shigella sonnei (strain Ss046)
Q47538 7.06e-25 102 33 6 224 2 tauB Taurine import ATP-binding protein TauB Escherichia coli (strain K12)
Q7MMN0 7.49e-25 102 36 7 225 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain YJ016)
Q8DFQ4 7.49e-25 102 36 7 225 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain CMCP6)
Q57243 8.22e-25 102 30 5 249 3 HI_1272 Uncharacterized ABC transporter ATP-binding protein HI_1272 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8Y651 9.25e-25 102 30 9 230 3 mntB Manganese transport system ATP-binding protein MntB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q1MQ44 9.47e-25 104 30 4 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Lawsonia intracellularis (strain PHE/MN1-00)
A1WXT0 9.63e-25 102 34 6 230 3 znuC Zinc import ATP-binding protein ZnuC Halorhodospira halophila (strain DSM 244 / SL1)
Q1RFH8 9.86e-25 102 34 6 219 3 tauB Taurine import ATP-binding protein TauB Escherichia coli (strain UTI89 / UPEC)
Q0TKS1 9.86e-25 102 34 6 219 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q2FRT7 1.03e-24 104 35 8 219 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q8KZR4 1.06e-24 102 33 4 205 3 tauB Taurine import ATP-binding protein TauB Pseudomonas putida
Q82JY6 1.07e-24 103 34 6 228 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8XK20 1.13e-24 105 30 8 249 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8XK20 8.99e-12 68 24 6 247 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8FKF5 1.13e-24 102 34 6 219 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q58488 1.29e-24 102 29 8 223 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q1IGM2 1.34e-24 102 33 4 205 3 tauB Taurine import ATP-binding protein TauB Pseudomonas entomophila (strain L48)
Q8Z0H0 1.34e-24 103 32 4 228 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9G4F5 1.41e-24 103 32 6 230 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q8DIA0 1.76e-24 103 34 4 223 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q4KK16 2.03e-24 101 34 5 206 3 tauB Taurine import ATP-binding protein TauB Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9I6L0 2.15e-24 102 30 4 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0KPH6 2.15e-24 101 34 7 230 3 znuC Zinc import ATP-binding protein ZnuC Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q2SJY7 2.18e-24 103 31 5 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Hahella chejuensis (strain KCTC 2396)
Q88RA1 2.3e-24 101 33 4 205 3 tauB Taurine import ATP-binding protein TauB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P10091 2.65e-24 103 31 5 229 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Marchantia polymorpha
Q14Q07 2.71e-24 102 31 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Spiroplasma citri
Q56927 2.87e-24 102 31 3 209 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia enterocolitica
P40790 3.29e-24 103 30 7 242 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57QC8 3.29e-24 103 30 7 242 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella choleraesuis (strain SC-B67)
Q8ES39 3.52e-24 104 28 7 260 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8ES39 4.8e-14 75 27 6 223 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q32IZ6 3.55e-24 100 34 5 210 3 tauB Taurine import ATP-binding protein TauB Shigella dysenteriae serotype 1 (strain Sd197)
Q4QK57 5.03e-24 102 28 5 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q132E8 5.61e-24 100 32 6 249 3 phnC Phosphonates import ATP-binding protein PhnC Rhodopseudomonas palustris (strain BisB5)
Q9JJ59 6.22e-24 103 29 8 265 1 Abcb9 ABC-type oligopeptide transporter ABCB9 Mus musculus
Q66D26 7.15e-24 100 31 7 247 3 phnC Phosphonates import ATP-binding protein PhnC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CFV9 7.15e-24 100 31 7 247 3 phnC Phosphonates import ATP-binding protein PhnC Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZGU5 7.15e-24 100 31 7 247 3 phnC Phosphonates import ATP-binding protein PhnC Yersinia pestis
Q1C9L0 7.15e-24 100 31 7 247 3 phnC Phosphonates import ATP-binding protein PhnC Yersinia pestis bv. Antiqua (strain Antiqua)
Q9MUN1 7.36e-24 101 31 5 228 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
A1JPQ1 7.43e-24 99 33 7 243 3 btuD Vitamin B12 import ATP-binding protein BtuD Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q98HF7 7.71e-24 102 32 8 267 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q62K82 7.82e-24 101 31 4 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q32EY4 8.67e-24 102 32 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella dysenteriae serotype 1 (strain Sd197)
Q63TY1 8.92e-24 101 31 4 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q83MA0 9.04e-24 99 33 6 224 3 tauB Taurine import ATP-binding protein TauB Shigella flexneri
Q3SGJ8 9.29e-24 99 30 6 258 3 phnC Phosphonates import ATP-binding protein PhnC Thiobacillus denitrificans (strain ATCC 25259)
Q8ELR4 1.03e-23 101 29 10 256 3 potA Spermidine/putrescine import ATP-binding protein PotA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q50801 1.04e-23 100 28 8 237 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q0T5R2 1.08e-23 101 32 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri serotype 5b (strain 8401)
Q03AH0 1.13e-23 101 29 9 247 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q5PMK1 1.2e-23 101 30 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q7MPC5 1.27e-23 99 33 5 223 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio vulnificus (strain YJ016)
Q8DE95 1.27e-23 99 33 5 223 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio vulnificus (strain CMCP6)
Q8Z7H7 1.28e-23 101 30 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhi
F2RPA4 1.31e-23 103 32 8 248 2 MDR4 ABC multidrug transporter MDR2 Trichophyton tonsurans (strain CBS 112818)
F2RPA4 2.22e-07 55 40 4 94 2 MDR4 ABC multidrug transporter MDR2 Trichophyton tonsurans (strain CBS 112818)
Q38VW6 1.35e-23 101 29 7 254 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
F2Q5G0 1.37e-23 103 32 8 248 2 MDR4 ABC multidrug transporter MDR2 Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
F2Q5G0 2.37e-07 55 40 4 94 2 MDR4 ABC multidrug transporter MDR2 Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
Q03ZQ0 1.4e-23 101 28 7 256 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q042G7 1.42e-23 101 28 4 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
A0A059JK44 1.45e-23 103 32 8 248 2 MDR4 ABC multidrug transporter MDR2 Trichophyton interdigitale (strain MR816)
A0A059JK44 2.33e-07 55 40 4 94 2 MDR4 ABC multidrug transporter MDR2 Trichophyton interdigitale (strain MR816)
A7MVV6 1.49e-23 99 34 4 224 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio campbellii (strain ATCC BAA-1116)
Q5X627 1.6e-23 100 30 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q8UA73 1.65e-23 100 33 6 229 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q6D4E2 1.91e-23 101 30 4 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q1GIE5 2.04e-23 100 32 8 243 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria sp. (strain TM1040)
O32188 2.36e-23 99 26 3 250 1 yusV Probable siderophore transport system ATP-binding protein YusV Bacillus subtilis (strain 168)
Q9QYJ4 2.4e-23 102 29 8 265 1 Abcb9 ABC-type oligopeptide transporter ABCB9 Rattus norvegicus
A3DDF6 2.44e-23 100 30 6 255 3 potA Spermidine/putrescine import ATP-binding protein PotA Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q7VNG4 2.5e-23 100 29 6 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q50966 2.52e-23 100 32 5 221 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae
Q3KJQ7 2.6e-23 98 34 5 206 3 tauB Taurine import ATP-binding protein TauB Pseudomonas fluorescens (strain Pf0-1)
P45171 2.82e-23 100 27 5 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O85818 3.22e-23 100 28 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
Q1R5D8 3.38e-23 98 35 6 222 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain UTI89 / UPEC)
Q8FCM9 3.38e-23 98 35 6 222 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBX8 3.38e-23 98 35 6 222 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
J9VWU3 3.52e-23 102 31 8 246 2 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
P56344 3.67e-23 97 32 10 229 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
P31134 3.73e-23 100 31 6 233 1 potG Putrescine transport ATP-binding protein PotG Escherichia coli (strain K12)
Q87PH3 3.84e-23 100 29 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q74K65 4.07e-23 100 28 4 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8F6Z1 4.3e-23 99 30 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PE5 4.3e-23 99 30 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q4W575 4.57e-23 99 32 5 222 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JVH1 4.57e-23 99 32 5 222 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P0CU83 4.87e-23 101 31 8 248 2 MDR4 ABC multidrug transporter MDR2 Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
P0CU83 9.03e-07 53 39 4 94 2 MDR4 ABC multidrug transporter MDR2 Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
Q5WBL0 4.99e-23 97 32 4 203 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Shouchella clausii (strain KSM-K16)
Q5ZWE4 5.25e-23 99 30 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q8PC11 5.4e-23 99 34 4 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B5QVV9 5.42e-23 97 33 7 232 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella enteritidis PT4 (strain P125109)
Q830W6 5.44e-23 99 29 6 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q7NX01 5.51e-23 99 32 5 237 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8DPC2 5.77e-23 99 30 8 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q42 5.77e-23 99 30 8 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JW0 5.77e-23 99 30 8 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P96117 5.86e-23 97 30 5 216 3 troB Zinc transport system ATP-binding protein TroB Treponema pallidum (strain Nichols)
Q926D8 5.89e-23 97 28 6 230 3 zurA Zinc uptake system ATP-binding protein ZurA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P63351 6.07e-23 97 33 7 232 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63352 6.07e-23 97 33 7 232 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella typhi
B4TGI0 6.07e-23 97 33 7 232 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella heidelberg (strain SL476)
B5FJ99 6.07e-23 97 33 7 232 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella dublin (strain CT_02021853)
Q57PU4 6.07e-23 97 33 7 232 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella choleraesuis (strain SC-B67)
Q88ZJ6 6.37e-23 99 31 8 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88YN5 6.54e-23 97 31 5 223 3 phnC Phosphonates import ATP-binding protein PhnC Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9NP78 7.23e-23 100 29 8 254 1 ABCB9 ABC-type oligopeptide transporter ABCB9 Homo sapiens
Q0T7M2 7.42e-23 97 33 6 224 3 tauB Taurine import ATP-binding protein TauB Shigella flexneri serotype 5b (strain 8401)
Q8RQL7 7.51e-23 97 30 6 212 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q1RD28 7.92e-23 99 31 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain UTI89 / UPEC)
A1AA20 7.92e-23 99 31 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O1:K1 / APEC
P69877 8e-23 99 31 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri
P69874 8e-23 99 31 6 221 1 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain K12)
P69875 8e-23 99 31 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIU8 8e-23 99 31 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P69876 8e-23 99 31 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O157:H7
Q6BXD7 8.04e-23 100 28 7 244 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
P0CL93 8.29e-23 100 31 8 243 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
Q9XDA6 8.38e-23 97 29 6 231 3 zurA Zinc uptake system ATP-binding protein ZurA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9X196 8.57e-23 99 31 6 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q81V82 8.72e-23 97 28 4 239 1 fpuD Petrobactin import ATP-binding protein FpuD Bacillus anthracis
P0CL92 8.78e-23 100 31 8 243 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
Q88AS5 9.53e-23 98 29 4 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q2ISN3 1.07e-22 97 31 6 249 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain HaA2)
Q6D201 1.09e-22 98 31 5 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P77795 1.11e-22 98 30 5 213 3 ydcT Uncharacterized ABC transporter ATP-binding protein YdcT Escherichia coli (strain K12)
P63354 1.14e-22 98 36 9 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella suis biovar 1 (strain 1330)
P63353 1.14e-22 98 36 9 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
B5BA33 1.15e-22 96 33 7 232 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella paratyphi A (strain AKU_12601)
Q5PH81 1.15e-22 96 33 7 232 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q3Z2Z3 1.18e-22 99 31 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella sonnei (strain Ss046)
Q31ZK0 1.18e-22 99 31 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella boydii serotype 4 (strain Sb227)
B7VPD0 1.19e-22 96 35 4 213 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio atlanticus (strain LGP32)
Q72FW5 1.33e-22 98 30 5 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q20Y31 1.37e-22 97 31 6 248 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain BisB18)
Q8DUF7 1.42e-22 98 29 8 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8XZP8 1.5e-22 98 32 3 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q81PZ8 1.51e-22 99 30 8 236 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q81PZ8 9.7e-13 71 25 10 259 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q5WXF0 1.62e-22 98 30 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
A0PY57 1.73e-22 97 28 5 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium novyi (strain NT)
Q93KD4 1.74e-22 95 30 6 224 1 tupC Tungstate uptake system ATP-binding protein TupC Peptoclostridium acidaminophilum
Q8PNN4 1.78e-22 97 34 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas axonopodis pv. citri (strain 306)
Q04G50 1.8e-22 98 26 4 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q8NR42 1.81e-22 95 34 5 206 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q32AQ1 1.82e-22 96 34 7 237 3 nikE Nickel import ATP-binding protein NikE Shigella dysenteriae serotype 1 (strain Sd197)
O34362 1.82e-22 99 30 6 241 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
O34362 5.34e-17 83 30 10 246 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
A3CMQ7 1.88e-22 98 29 8 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus sanguinis (strain SK36)
Q9A7X1 1.89e-22 97 33 5 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q20ZP0 2.21e-22 96 30 5 238 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisB18)
Q82WT5 2.28e-22 97 31 5 223 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q93DX8 2.55e-22 95 30 4 226 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q0S0X2 2.72e-22 95 33 4 202 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Rhodococcus jostii (strain RHA1)
O68106 2.73e-22 96 30 6 239 1 cbiO Cobalt import ATP-binding protein CbiO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P33594 2.8e-22 95 34 7 237 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain K12)
Q9KS33 2.88e-22 97 28 6 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q3YW48 2.89e-22 95 35 6 222 3 nikE Nickel import ATP-binding protein NikE Shigella sonnei (strain Ss046)
Q8X4L6 2.89e-22 95 35 6 219 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O157:H7
A3CVD3 2.91e-22 96 32 4 195 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q8XNY7 2.98e-22 96 27 5 255 3 CPE0195 Putative ABC transporter ATP-binding protein CPE0195 Clostridium perfringens (strain 13 / Type A)
Q0TUN8 3.17e-22 96 27 5 255 1 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q6HI76 3.35e-22 99 30 8 236 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HI76 8.76e-13 71 25 10 259 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q9K876 3.51e-22 97 29 4 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q737I0 3.65e-22 99 30 5 230 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q737I0 3.78e-12 69 24 8 258 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6CX96 3.69e-22 99 29 6 235 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q21GS5 3.72e-22 97 32 8 241 3 modC Molybdenum import ATP-binding protein ModC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q110U3 4.1e-22 97 30 4 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichodesmium erythraeum (strain IMS101)
O31339 4.47e-22 97 29 4 222 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q1RB86 4.92e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain UTI89 / UPEC)
Q8FH28 4.92e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0THB9 4.92e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABP5 4.92e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O1:K1 / APEC
B7MV91 4.92e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O81 (strain ED1a)
B7MAS0 4.92e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O45:K1 (strain S88 / ExPEC)
B7US48 4.92e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q87Q38 5.24e-22 95 32 5 224 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q03JH1 5.64e-22 97 28 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q16BC5 5.72e-22 95 30 6 242 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B5YPZ7 5.87e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X5W0 5.87e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O157:H7
Q0SWH9 6.3e-22 95 27 5 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain SM101 / Type A)
Q88ZZ2 6.48e-22 98 30 6 245 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88ZZ2 4.07e-17 84 28 7 258 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8E8K8 7.07e-22 96 30 5 220 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q5M397 7.16e-22 96 28 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LYN4 7.31e-22 96 28 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain CNRZ 1066)
Q89C51 7.36e-22 94 32 6 240 3 phnC Phosphonates import ATP-binding protein PhnC Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q7W9U5 7.43e-22 96 30 4 223 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7MKU3 7.53e-22 96 28 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain YJ016)
Q8D9J4 7.53e-22 96 28 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain CMCP6)
Q8Y8T6 7.63e-22 96 28 7 241 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q7NIW1 7.66e-22 96 32 4 228 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q7WGW1 7.9e-22 96 30 4 223 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q73F67 8.2e-22 95 30 8 238 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)
A0R6H7 8.7e-22 97 32 11 259 1 irtB Mycobactin import ATP-binding/permease protein IrtB Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
B2U358 8.96e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q3Z257 9.05e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella sonnei (strain Ss046)
Q7C1M3 9.05e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella flexneri
Q0T4R9 9.05e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella flexneri serotype 5b (strain 8401)
Q32FJ0 9.05e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella dysenteriae serotype 1 (strain Sd197)
B1LE21 9.05e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain SMS-3-5 / SECEC)
B6I8R4 9.05e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain SE11)
B7N547 9.05e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1IPL8 9.05e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0Q1 9.05e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O9:H4 (strain HS)
B7M1B8 9.05e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O8 (strain IAI1)
B7NTS2 9.05e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7L6I2 9.05e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain 55989 / EAEC)
A7ZMH7 9.05e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O139:H28 (strain E24377A / ETEC)
Q2SSS4 9.23e-22 95 30 5 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
P06611 9.94e-22 94 34 4 216 1 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain K12)
B1XG16 9.94e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain K12 / DH10B)
C4ZYH1 9.94e-22 94 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain K12 / MC4100 / BW2952)
Q73GK9 9.98e-22 94 25 4 238 3 znuC Zinc import ATP-binding protein ZnuC Wolbachia pipientis wMel
Q31DV4 1.01e-21 94 29 4 251 3 phnC Phosphonates import ATP-binding protein PhnC Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P74548 1.07e-21 95 31 4 226 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q88CL2 1.19e-21 95 30 4 228 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q47T99 1.23e-21 96 31 8 262 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermobifida fusca (strain YX)
Q6MU19 1.34e-21 95 29 5 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q18AM3 1.34e-21 95 29 6 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridioides difficile (strain 630)
Q87UH7 1.35e-21 94 32 4 207 3 tauB Taurine import ATP-binding protein TauB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q30V33 1.38e-21 95 29 5 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q5HQ70 1.4e-21 95 29 8 249 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q2RS22 1.41e-21 94 33 6 217 3 nikE Nickel import ATP-binding protein NikE Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q321G6 1.44e-21 93 34 4 216 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella boydii serotype 4 (strain Sb227)
Q8UH62 1.45e-21 95 34 6 221 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
A0AGP9 1.46e-21 95 28 7 241 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q3MGT2 1.47e-21 93 33 4 220 3 phnC Phosphonates import ATP-binding protein PhnC Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q6D654 1.48e-21 93 33 7 232 3 btuD Vitamin B12 import ATP-binding protein BtuD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7M8M4 1.53e-21 94 29 7 249 3 phnC Phosphonates import ATP-binding protein PhnC Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q722B1 1.65e-21 95 28 7 241 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serotype 4b (strain F2365)
Q59R09 1.69e-21 97 27 6 238 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Candida albicans (strain SC5314 / ATCC MYA-2876)
Q3IM24 1.77e-21 94 27 4 228 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q6MCV4 1.9e-21 95 29 5 243 3 potA Spermidine/putrescine import ATP-binding protein PotA Protochlamydia amoebophila (strain UWE25)
Q0I3Y9 1.94e-21 95 27 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
Q2SIN5 1.95e-21 96 30 6 228 3 msbA ATP-dependent lipid A-core flippase Hahella chejuensis (strain KCTC 2396)
Q0SML1 2.11e-21 95 29 6 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
Q60AI1 2.12e-21 95 34 5 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
P47425 2.2e-21 93 28 6 224 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q5YZY9 2.49e-21 94 31 4 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nocardia farcinica (strain IFM 10152)
Q1LNM0 2.52e-21 94 34 7 215 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q31VE6 2.67e-21 93 34 6 222 3 nikE Nickel import ATP-binding protein NikE Shigella boydii serotype 4 (strain Sb227)
A1URR2 2.68e-21 94 29 7 228 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q49WM4 2.69e-21 95 26 5 255 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q97N51 2.76e-21 93 29 9 248 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q9KLQ5 2.9e-21 94 32 7 229 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q85A69 3.01e-21 95 32 5 224 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Anthoceros angustus
Q92DL6 3.35e-21 94 28 7 241 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q7VZE5 3.42e-21 94 30 4 223 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q65UE1 3.43e-21 94 26 5 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q68W42 3.57e-21 95 26 7 240 3 RT0691 Putative export ATP-binding/permease protein RT0691 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q6LR20 3.75e-21 94 26 6 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Photobacterium profundum (strain SS9)
Q0A9E2 3.76e-21 92 32 5 219 3 znuC Zinc import ATP-binding protein ZnuC Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q87RE5 3.77e-21 92 31 5 216 3 znuC Zinc import ATP-binding protein ZnuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q65S66 3.84e-21 94 29 9 268 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q50294 4.02e-21 92 27 7 255 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q8YUI9 4.16e-21 92 32 4 220 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
O34338 4.21e-21 92 31 7 254 2 mntB Manganese transport system ATP-binding protein MntB Bacillus subtilis (strain 168)
O51587 4.39e-21 94 29 6 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q6F9A8 4.61e-21 94 31 4 223 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q8DMY0 4.89e-21 92 29 9 248 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04HV8 4.89e-21 92 29 9 248 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P47705 5.06e-21 93 28 4 212 3 MG467 Putative ABC transporter ATP-binding protein MG467 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q660M8 5.65e-21 94 29 6 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q5LUR8 5.71e-21 92 32 5 224 3 znuC Zinc import ATP-binding protein ZnuC Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q0K9I2 5.75e-21 93 36 7 207 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1QE80 5.88e-21 94 33 4 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q83KR7 6.08e-21 92 36 6 217 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri
Q0T3U8 6.08e-21 92 36 6 217 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri serotype 5b (strain 8401)
Q6NBX6 6.21e-21 92 30 6 248 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q81J16 6.23e-21 92 29 8 235 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81GC1 6.48e-21 93 27 5 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2SPI3 6.61e-21 92 30 5 217 3 znuC1 Zinc import ATP-binding protein ZnuC 1 Hahella chejuensis (strain KCTC 2396)
Q8XZQ4 6.65e-21 92 36 7 213 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q6LKD4 6.74e-21 93 31 7 229 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photobacterium profundum (strain SS9)
A0LUE6 6.86e-21 94 31 9 259 3 potA Spermidine/putrescine import ATP-binding protein PotA Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q89UD2 6.87e-21 93 31 6 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q2GFZ6 6.92e-21 91 28 8 239 3 znuC Zinc import ATP-binding protein ZnuC Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q72AQ6 7.28e-21 92 27 5 240 3 phnC Phosphonates import ATP-binding protein PhnC Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q8FVN0 7.41e-21 92 28 6 265 2 nikE Nickel import ATP-binding protein NikE Brucella suis biovar 1 (strain 1330)
Q6HPN0 7.57e-21 92 30 8 238 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 7.57e-21 92 30 8 238 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 7.57e-21 92 30 8 238 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
Q9HX79 7.87e-21 92 30 5 228 3 tauB Taurine import ATP-binding protein TauB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5E586 7.92e-21 93 28 6 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q4UMZ3 8.01e-21 94 27 10 243 3 RF_0214 Putative export ATP-binding/permease protein RF_0214 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q5UW69 8.24e-21 92 27 5 254 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q9KFL0 8.39e-21 91 28 4 221 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P21958 8.61e-21 95 32 6 238 1 Tap1 Antigen peptide transporter 1 Mus musculus
A8AHA1 8.67e-21 91 34 6 210 3 btuD Vitamin B12 import ATP-binding protein BtuD Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A0R6H8 8.67e-21 95 34 9 234 1 irtA Mycobactin import ATP-binding/permease protein IrtA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q58967 8.71e-21 92 30 7 214 3 MJ1572 Putative ABC transporter ATP-binding protein MJ1572 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8TTN2 8.9e-21 94 28 7 223 3 MA_0394 Putative ABC transporter ATP-binding protein MA_0394 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q5QU46 8.9e-21 90 32 5 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q3KBH4 8.99e-21 93 31 5 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas fluorescens (strain Pf0-1)
Q32HA3 9.47e-21 91 35 5 217 3 znuC Zinc import ATP-binding protein ZnuC Shigella dysenteriae serotype 1 (strain Sd197)
Q0RAT5 9.81e-21 94 30 4 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q160M2 1.01e-20 93 30 6 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q0SZJ3 1.04e-20 91 34 7 237 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri serotype 5b (strain 8401)
Q609Q1 1.1e-20 93 32 4 223 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q3M5J9 1.11e-20 91 33 4 202 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8CPN0 1.16e-20 93 28 8 249 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q0ASQ1 1.21e-20 91 28 7 258 3 phnC Phosphonates import ATP-binding protein PhnC Maricaulis maris (strain MCS10)
Q8Z5W6 1.25e-20 91 35 5 217 3 znuC Zinc import ATP-binding protein ZnuC Salmonella typhi
Q6FFL0 1.26e-20 91 29 4 228 3 znuC Zinc import ATP-binding protein ZnuC Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q5PIA5 1.29e-20 91 35 4 208 3 znuC Zinc import ATP-binding protein ZnuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57NA5 1.29e-20 91 35 4 208 3 znuC Zinc import ATP-binding protein ZnuC Salmonella choleraesuis (strain SC-B67)
Q64SQ6 1.33e-20 94 29 5 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain YCH46)
Q8DZJ0 1.36e-20 93 28 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E554 1.36e-20 93 28 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype III (strain NEM316)
Q3K0Y6 1.36e-20 93 28 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q5P4W2 1.39e-20 93 32 5 228 3 modC Molybdenum import ATP-binding protein ModC Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q5LBT4 1.45e-20 93 29 5 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q2FNX9 1.5e-20 91 27 5 227 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q7N3A6 1.65e-20 90 30 5 225 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8A883 1.66e-20 93 28 5 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q9KLL9 1.7e-20 92 33 4 207 3 modC Molybdenum import ATP-binding protein ModC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5FL41 1.76e-20 92 26 5 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q8CUY0 1.76e-20 90 30 11 249 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q1B8V9 1.77e-20 92 27 7 263 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain MCS)
A1UG51 1.77e-20 92 27 7 263 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain KMS)
Q7CN92 1.79e-20 92 28 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q99ZS8 1.79e-20 92 28 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M1
P42360 1.85e-20 90 28 9 244 1 scaC Manganese import ATP-binding protein ScaC Streptococcus gordonii
Q8ZNV7 1.89e-20 90 35 5 217 2 znuC Zinc import ATP-binding protein ZnuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P54537 1.97e-20 90 30 7 220 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q21XJ9 1.97e-20 91 30 4 224 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q6CYU2 2e-20 90 34 6 204 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9PDN2 2.04e-20 92 33 5 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
Q46ZU5 2.05e-20 91 36 6 207 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q92GP9 2.07e-20 93 25 9 243 3 RC1073 Putative export ATP-binding/permease protein RC1073 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P0CZ35 2.21e-20 92 29 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TP4 2.21e-20 92 29 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M28 (strain MGAS6180)
P0CZ34 2.21e-20 92 29 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q16BJ3 2.23e-20 90 29 4 207 3 tauB Taurine import ATP-binding protein TauB Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q2LVL0 2.28e-20 93 29 10 242 3 msbA ATP-dependent lipid A-core flippase Syntrophus aciditrophicus (strain SB)
Q3Z2L6 2.44e-20 90 35 5 217 3 znuC Zinc import ATP-binding protein ZnuC Shigella sonnei (strain Ss046)
Q322E8 2.44e-20 90 35 5 217 3 znuC Zinc import ATP-binding protein ZnuC Shigella boydii serotype 4 (strain Sb227)
Q1RAS6 2.44e-20 90 35 5 217 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain UTI89 / UPEC)
P0A9X1 2.44e-20 90 35 5 217 1 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain K12)
P0A9X2 2.44e-20 90 35 5 217 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGX4 2.44e-20 90 35 5 217 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AC19 2.44e-20 90 35 5 217 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O1:K1 / APEC
P0A9X3 2.44e-20 90 35 5 217 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O157:H7
Q2K2X0 2.46e-20 92 29 4 209 3 modC Molybdenum import ATP-binding protein ModC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8YCN7 2.48e-20 90 27 6 265 3 nikE Nickel import ATP-binding protein NikE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S7 2.48e-20 90 27 6 265 3 nikE Nickel import ATP-binding protein NikE Brucella abortus biovar 1 (strain 9-941)
Q2YL69 2.48e-20 90 27 6 265 3 nikE Nickel import ATP-binding protein NikE Brucella abortus (strain 2308)
Q31I51 2.49e-20 90 31 5 219 3 znuC Zinc import ATP-binding protein ZnuC Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q57QD7 2.52e-20 90 31 4 207 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella choleraesuis (strain SC-B67)
Q38UT9 2.52e-20 90 28 5 214 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q1WVI7 2.54e-20 92 28 8 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
Q664P8 2.57e-20 90 30 5 221 3 tauB Taurine import ATP-binding protein TauB Yersinia pseudotuberculosis serotype I (strain IP32953)
Q5XCA4 2.69e-20 92 29 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q9I2N4 2.69e-20 92 31 6 231 3 modC Molybdenum import ATP-binding protein ModC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1GCR8 2.82e-20 89 32 4 189 3 thiQ Thiamine import ATP-binding protein ThiQ Ruegeria sp. (strain TM1040)
Q3SJC6 2.86e-20 92 31 5 219 3 modC Molybdenum import ATP-binding protein ModC Thiobacillus denitrificans (strain ATCC 25259)
Q1CCR9 2.9e-20 90 30 5 221 3 tauB Taurine import ATP-binding protein TauB Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZJD0 2.9e-20 90 30 5 221 3 tauB Taurine import ATP-binding protein TauB Yersinia pestis
Q1C2S1 2.9e-20 90 30 5 221 3 tauB Taurine import ATP-binding protein TauB Yersinia pestis bv. Antiqua (strain Antiqua)
Q2FVF1 2.92e-20 90 30 4 231 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q9CP06 3.15e-20 92 28 6 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
Q9CIQ6 3.25e-20 90 29 8 251 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. lactis (strain IL1403)
Q2JB14 3.27e-20 90 29 6 242 3 phnC Phosphonates import ATP-binding protein PhnC Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q02SA6 3.27e-20 90 30 5 228 3 tauB Taurine import ATP-binding protein TauB Pseudomonas aeruginosa (strain UCBPP-PA14)
Q1J6Q6 3.34e-20 92 28 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGY7 3.34e-20 92 28 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JLT7 3.34e-20 92 28 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBV6 3.34e-20 92 28 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q4L5B3 3.35e-20 92 27 7 256 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus haemolyticus (strain JCSC1435)
Q3J1N0 3.62e-20 91 30 6 223 3 metN Methionine import ATP-binding protein MetN Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q04BG2 3.63e-20 91 26 4 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_05755
Feature type CDS
Gene fepC
Product heme ABC transporter ATP-binding protein
Location 217486 - 218286 (strand: -1)
Length 801 (nucleotides) / 266 (amino acids)
In genomic island -

Contig

Accession ZDB_682
Length 259781 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_404
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4559 Inorganic ion transport and metabolism (P) P ABC-type hemin transport system, ATPase component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02013 iron complex transport system ATP-binding protein [EC:7.2.2.-] - -

Protein Sequence

MPRITANNPPPVLVAENVSFSRHGQPVVSDISLALHCGTITAVTGPNGAGKSTLLRLLSGYYPCDSGQIMLRGKPMASWSAGALAQIRAVMTQQSVITAPYRVRDIIALGDLHREYTQQATTDEVIHLTACEPLLEKRWYQLSGGEQQRVHLARALMQLSCPLPLPRLLLLDEPTAALDLHHQQHLMRMLKHRVSTTSLAVFCILHDLNLASLYADHVIMLNNGRIARQGTPGGVLQKTVLAETYQADLITLRHPLTGNTSVLLAP

Flanking regions ( +/- flanking 50bp)

GCTTGGCGCACCCTATTTTCTCTGGCTGATTTTCTCTGTGAAGGAATGATATGCCCCGTATAACCGCCAATAATCCGCCACCAGTGCTGGTTGCAGAGAATGTCAGTTTTTCCCGCCACGGACAGCCGGTAGTCAGTGATATCTCCCTGGCTTTGCACTGCGGAACCATCACTGCGGTTACCGGCCCGAACGGCGCAGGTAAATCAACCCTTCTTCGTTTACTCAGCGGCTATTATCCCTGTGACAGCGGGCAGATCATGCTGCGCGGAAAACCAATGGCGTCCTGGTCTGCCGGTGCTCTGGCACAAATCAGGGCGGTAATGACACAACAAAGTGTTATCACTGCCCCTTACCGGGTCAGAGACATTATTGCGCTGGGGGATTTGCACCGGGAATACACACAACAGGCAACCACAGATGAAGTGATACACCTGACGGCCTGTGAACCACTGCTGGAGAAACGCTGGTATCAGCTTTCCGGAGGTGAACAACAGCGGGTTCATCTGGCGCGCGCGCTGATGCAACTAAGCTGTCCGCTGCCTCTCCCCCGTCTGTTATTACTGGATGAACCGACTGCCGCACTGGATCTTCACCACCAACAGCACCTGATGCGGATGCTGAAACATCGGGTAAGCACGACCTCCCTGGCGGTCTTCTGTATCCTGCATGATCTGAATCTGGCCTCTTTATATGCTGATCACGTCATAATGCTGAATAACGGGCGCATTGCCCGTCAGGGAACACCGGGCGGAGTGCTGCAAAAAACGGTACTGGCGGAAACTTATCAGGCAGACCTGATAACGCTCCGCCATCCGCTTACCGGCAATACATCTGTGTTACTTGCGCCTTAATGTTGCTCAGGTTTTGCCGTAACCCGTTGTTTGCGGCAAAACATGATTGC