Homologs in group_750

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03340 FBDBKF_03340 100.0 Morganella morganii S1 mreD rod shape-determining protein MreD
EHELCC_07195 EHELCC_07195 100.0 Morganella morganii S2 mreD rod shape-determining protein MreD
NLDBIP_07520 NLDBIP_07520 100.0 Morganella morganii S4 mreD rod shape-determining protein MreD
LHKJJB_07055 LHKJJB_07055 100.0 Morganella morganii S3 mreD rod shape-determining protein MreD
F4V73_RS11595 F4V73_RS11595 94.4 Morganella psychrotolerans mreD rod shape-determining protein MreD
PMI_RS18075 PMI_RS18075 62.3 Proteus mirabilis HI4320 mreD rod shape-determining protein MreD

Distribution of the homologs in the orthogroup group_750

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_750

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABH4 3.02e-67 204 59 0 162 1 mreD Rod shape-determining protein MreD Escherichia coli (strain K12)
P0ABH5 3.02e-67 204 59 0 162 3 mreD Rod shape-determining protein MreD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABH6 3.02e-67 204 59 0 162 3 mreD Rod shape-determining protein MreD Escherichia coli O157:H7
P44476 7.88e-34 119 44 0 147 3 mreD Rod shape-determining protein MreD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_03875
Feature type CDS
Gene mreD
Product rod shape-determining protein MreD
Location 92283 - 92771 (strand: -1)
Length 489 (nucleotides) / 162 (amino acids)

Contig

Accession ZDB_681
Length 269562 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_750
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04093 rod shape-determining protein MreD

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2891 Cell wall/membrane/envelope biogenesis (M) M Cell shape-determining protein MreD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03571 rod shape-determining protein MreD - -

Protein Sequence

MNTYRGQNRIIVWLSFLIALVLQIMPWPEQIQFYRPSWAMLFLIYWVMALPHRVSVGSAFFLGMIIDLIEGSTLGVHALSLSIVTYLVSFRHQLLRNMALWQQSLVIMVLSVLMQFFVFWSEFLLSDIVFHPEVFWNSLVNGILWPWIFLLLRKTRRHFSVH

Flanking regions ( +/- flanking 50bp)

CCGGCTGCTGATTCCGCACCGGCCCGGCCGCTGAGGATGAGGCCGCAACAATGAATACCTACCGGGGACAAAACCGGATTATTGTCTGGCTCTCCTTTCTGATAGCACTGGTACTGCAAATCATGCCCTGGCCGGAGCAGATTCAGTTTTACCGTCCGTCGTGGGCGATGCTGTTTCTTATCTACTGGGTGATGGCGCTGCCGCACCGGGTCAGTGTCGGCTCCGCTTTCTTTCTCGGCATGATCATTGACCTGATTGAAGGTTCCACGCTCGGCGTGCATGCCCTGAGCCTGTCTATCGTCACCTATCTGGTCTCATTCAGACATCAGCTGCTGCGCAATATGGCGCTGTGGCAGCAGTCGCTGGTCATTATGGTGCTGTCAGTGCTGATGCAGTTCTTTGTTTTCTGGTCAGAATTTTTATTGTCCGATATTGTGTTTCATCCGGAAGTCTTCTGGAACAGTCTGGTCAATGGTATCTTATGGCCATGGATTTTTTTATTACTGCGTAAGACCCGCCGTCACTTTTCTGTTCATTAATCAGGGAACGGCGGCGTGATACGTTAACAAAACGTCAGGACCCCTGAATG