Homologs in group_821

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03340 FBDBKF_03340 62.3 Morganella morganii S1 mreD rod shape-determining protein MreD
EHELCC_07195 EHELCC_07195 62.3 Morganella morganii S2 mreD rod shape-determining protein MreD
NLDBIP_07520 NLDBIP_07520 62.3 Morganella morganii S4 mreD rod shape-determining protein MreD
LHKJJB_07055 LHKJJB_07055 62.3 Morganella morganii S3 mreD rod shape-determining protein MreD
HKOGLL_03875 HKOGLL_03875 62.3 Morganella morganii S5 mreD rod shape-determining protein MreD
F4V73_RS11595 F4V73_RS11595 63.6 Morganella psychrotolerans mreD rod shape-determining protein MreD

Distribution of the homologs in the orthogroup group_821

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_821

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABH4 8.9e-69 208 63 0 162 1 mreD Rod shape-determining protein MreD Escherichia coli (strain K12)
P0ABH5 8.9e-69 208 63 0 162 3 mreD Rod shape-determining protein MreD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABH6 8.9e-69 208 63 0 162 3 mreD Rod shape-determining protein MreD Escherichia coli O157:H7
P44476 1.15e-30 111 41 0 147 3 mreD Rod shape-determining protein MreD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18075
Feature type CDS
Gene mreD
Product rod shape-determining protein MreD
Location 3970666 - 3971154 (strand: 1)
Length 489 (nucleotides) / 162 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_821
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04093 rod shape-determining protein MreD

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2891 Cell wall/membrane/envelope biogenesis (M) M Cell shape-determining protein MreD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03571 rod shape-determining protein MreD - -

Protein Sequence

MNPYRSRGRWIIWLSFLIALVLQIMPWPEQLEVYRPIWPVLFLIYWITSLPHRISVGTAFVLGMSMDLVQGTTLGVNALAYTLVSYVIAFKYQLFCNLALWQQALVVMLAIGVVDLTVFWAEFLLSPVTFHPQVFWNSPVSGILWPWLYFLLRKVRHQFSVH

Flanking regions ( +/- flanking 50bp)

ACGGAAAACAATAAACCTCAACCTAATACGAATCGAGGTAGATAGTGACAATCAATCCTTATCGTAGCCGTGGGCGTTGGATTATTTGGCTCTCGTTTCTAATAGCTTTGGTGTTACAAATTATGCCTTGGCCTGAGCAACTAGAAGTTTATCGCCCTATTTGGCCAGTGTTGTTTCTGATTTATTGGATAACGTCATTACCTCATCGTATTAGCGTTGGAACAGCATTTGTTCTTGGGATGAGCATGGATTTAGTGCAAGGGACAACATTAGGCGTAAATGCGTTGGCTTATACCCTAGTAAGTTATGTTATCGCCTTTAAATATCAATTATTTTGTAACTTAGCGTTATGGCAACAGGCATTAGTGGTAATGTTAGCGATTGGTGTGGTTGATCTTACTGTATTTTGGGCAGAATTTTTGCTTTCTCCCGTGACTTTTCACCCACAAGTATTCTGGAATAGTCCAGTCAGTGGTATTCTTTGGCCATGGCTTTATTTTTTGCTTCGCAAAGTCCGTCACCAGTTTTCAGTTCATTAACCTCTCTGGATCATGACGGTATTTTTGTGTCACCGTCATGAGGATATTAT