Homologs in group_513

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01065 FBDBKF_01065 100.0 Morganella morganii S1 pilF Type IV pilus assembly protein PilF/PilW
EHELCC_00480 EHELCC_00480 100.0 Morganella morganii S2 pilF Type IV pilus assembly protein PilF/PilW
NLDBIP_02980 NLDBIP_02980 100.0 Morganella morganii S4 pilF Type IV pilus assembly protein PilF/PilW
LHKJJB_04495 LHKJJB_04495 100.0 Morganella morganii S3 pilF Type IV pilus assembly protein PilF/PilW
F4V73_RS07140 F4V73_RS07140 78.4 Morganella psychrotolerans - hypothetical protein
PMI_RS09115 PMI_RS09115 36.0 Proteus mirabilis HI4320 - hypothetical protein

Distribution of the homologs in the orthogroup group_513

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_513

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_02550
Feature type CDS
Gene pilF
Product Type IV pilus assembly protein PilF/PilW
Location 114418 - 114768 (strand: 1)
Length 351 (nucleotides) / 116 (amino acids)

Contig

Accession ZDB_680
Length 282413 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_513
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13428 Tetratricopeptide repeat

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4235 Energy production and conversion (C)
Posttranslational modification, protein turnover, chaperones (O)		 CO Cytochrome c-type biogenesis protein CcmH/NrfG

Protein Sequence

MIRTYSPGLIAVMLLAGCRTAPVTQTVPAATGTRLALGEAYLQAGRYDAARYHFDRVLKAQPQHTGALTGAALSAKCDQQPEIAEKYLNLAVNSPSGSDSVVQYILAYECPPDNSL

Flanking regions ( +/- flanking 50bp)

CCCGGTGACTGTTTACGTTAATATACCTGCCTTACAGACAAGGAGGCAGTATGATAAGGACGTATTCCCCGGGATTAATTGCAGTAATGCTGCTGGCAGGATGCCGGACAGCACCCGTGACACAGACCGTACCGGCTGCGACCGGTACCCGTCTTGCACTGGGTGAGGCTTATCTTCAGGCCGGCCGGTATGATGCCGCACGGTATCATTTTGACCGGGTACTGAAAGCACAGCCGCAGCATACCGGTGCGCTGACAGGTGCGGCGCTGAGTGCAAAATGCGATCAGCAGCCTGAAATTGCGGAAAAATACCTGAATTTAGCCGTGAATTCCCCGTCAGGCAGTGATAGTGTGGTACAGTACATTTTGGCTTATGAGTGTCCGCCGGATAACAGTCTGTAAAACAATATAAAAGTGATGTTGTTTTCAGGATTATTTTTATCATTACGGGT