Homologs in group_590

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01065 FBDBKF_01065 78.4 Morganella morganii S1 pilF Type IV pilus assembly protein PilF/PilW
EHELCC_00480 EHELCC_00480 78.4 Morganella morganii S2 pilF Type IV pilus assembly protein PilF/PilW
NLDBIP_02980 NLDBIP_02980 78.4 Morganella morganii S4 pilF Type IV pilus assembly protein PilF/PilW
LHKJJB_04495 LHKJJB_04495 78.4 Morganella morganii S3 pilF Type IV pilus assembly protein PilF/PilW
HKOGLL_02550 HKOGLL_02550 78.4 Morganella morganii S5 pilF Type IV pilus assembly protein PilF/PilW
PMI_RS09115 PMI_RS09115 35.1 Proteus mirabilis HI4320 - hypothetical protein

Distribution of the homologs in the orthogroup group_590

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_590

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07140
Feature type CDS
Gene -
Product hypothetical protein
Location 1482737 - 1483087 (strand: -1)
Length 351 (nucleotides) / 116 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_590
Orthogroup size 7
N. genomes 7

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4235 Energy production and conversion (C)
Posttranslational modification, protein turnover, chaperones (O)
CO Cytochrome c-type biogenesis protein CcmH/NrfG

Protein Sequence

MIRMYYPGLLGLVLLAGCRTAPVTQAPLTAVNTRLALGEAYLHAGHYDAARYHYDRVLKVQSQHTVALTGMALAAKCDQQPEIAEKYLNLAVNSPSGSDTVVQYVSAYSCLPDNSL

Flanking regions ( +/- flanking 50bp)

CCCGGTGTTTATTTACGATAAAATATCTGCCTCACCGTAAAGGAGGCAGTATGATAAGGATGTATTACCCGGGATTATTAGGATTAGTGCTGCTGGCAGGATGCCGGACAGCACCGGTTACGCAGGCACCGCTGACAGCGGTAAATACGCGGCTGGCGCTGGGAGAGGCCTATCTTCATGCCGGACATTATGATGCTGCACGTTATCATTATGACCGGGTATTGAAGGTACAATCGCAGCATACCGTGGCTCTGACCGGAATGGCGCTGGCAGCAAAGTGCGACCAGCAACCTGAAATTGCGGAAAAATACCTAAATTTAGCCGTGAATTCCCCGTCAGGCAGTGATACTGTGGTACAGTACGTTTCGGCCTATTCGTGTTTGCCGGATAACAGCTTGTAAAACAACATAAAACAGATGTTGTTTTCGACGTTATTTTGCCCTTAATGGTA