Homologs in group_525

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01130 FBDBKF_01130 100.0 Morganella morganii S1 iscU Fe-S cluster assembly scaffold protein IscU, NifU family
EHELCC_00415 EHELCC_00415 100.0 Morganella morganii S2 iscU Fe-S cluster assembly scaffold protein IscU, NifU family
NLDBIP_03045 NLDBIP_03045 100.0 Morganella morganii S4 iscU Fe-S cluster assembly scaffold protein IscU, NifU family
LHKJJB_04560 LHKJJB_04560 100.0 Morganella morganii S3 iscU Fe-S cluster assembly scaffold protein IscU, NifU family
F4V73_RS07200 F4V73_RS07200 96.9 Morganella psychrotolerans iscU Fe-S cluster assembly scaffold IscU
PMI_RS09175 PMI_RS09175 97.7 Proteus mirabilis HI4320 iscU Fe-S cluster assembly scaffold IscU

Distribution of the homologs in the orthogroup group_525

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_525

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACD7 2.49e-81 237 90 0 126 3 iscU Iron-sulfur cluster assembly scaffold protein IscU Shigella flexneri
P0ACD4 2.49e-81 237 90 0 126 1 iscU Iron-sulfur cluster assembly scaffold protein IscU Escherichia coli (strain K12)
P0ACD5 2.49e-81 237 90 0 126 3 iscU Iron-sulfur cluster assembly scaffold protein IscU Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACD6 2.49e-81 237 90 0 126 1 iscU Iron-sulfur cluster assembly scaffold protein IscU Escherichia coli O157:H7
Q57074 8.47e-77 226 84 0 125 1 iscU Iron-sulfur cluster assembly scaffold protein IscU Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O51885 2.25e-76 224 82 0 128 3 iscU Iron-sulfur cluster assembly scaffold protein IscU Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
O31270 3.77e-75 221 81 0 125 1 iscU Iron-sulfur cluster assembly scaffold protein IscU Azotobacter vinelandii
Q89A18 1.02e-72 215 82 0 126 3 nifU Iron-sulfur cluster assembly scaffold protein IscU Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P57658 1.41e-72 215 80 0 125 3 iscU Iron-sulfur cluster assembly scaffold protein IscU Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9ZD61 2.7e-68 204 76 0 125 3 iscU Iron-sulfur cluster assembly scaffold protein IscU Rickettsia prowazekii (strain Madrid E)
Q9D7P6 7.22e-65 197 74 0 123 1 Iscu Iron-sulfur cluster assembly enzyme ISCU Mus musculus
Q6CFQ0 8.45e-65 197 72 0 124 3 ISU1 Iron sulfur cluster assembly protein 1, mitochondrial Yarrowia lipolytica (strain CLIB 122 / E 150)
Q9H1K1 8.9e-65 197 74 0 123 1 ISCU Iron-sulfur cluster assembly enzyme ISCU Homo sapiens
O49627 8.59e-64 194 72 1 124 1 ISU1 Iron-sulfur cluster assembly protein 1 Arabidopsis thaliana
Q8LR34 2.01e-63 193 70 1 125 2 ISU1 Iron-sulfur cluster assembly protein 1 Oryza sativa subsp. japonica
Q03020 2.4e-62 191 72 1 124 1 ISU1 Iron sulfur cluster assembly protein 1, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q75C07 4.77e-62 189 70 1 127 3 ISU1 Iron sulfur cluster assembly protein 1, mitochondrial Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q6CRQ9 4.94e-62 190 71 1 124 3 ISU1 Iron sulfur cluster assembly protein 1, mitochondrial Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q6BGU0 7.58e-62 190 70 1 124 3 ISU1 Iron sulfur cluster assembly protein 1, mitochondrial Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
O81433 7.86e-61 187 68 0 123 2 ISU3 Iron-sulfur cluster assembly protein 3 Arabidopsis thaliana
Q6FJY3 1.13e-60 188 72 1 124 3 ISU1 Iron sulfur cluster assembly protein 1, mitochondrial Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q8SSM2 1.6e-60 185 68 0 124 3 ISU1 Iron sulfur cluster assembly protein 1 Encephalitozoon cuniculi (strain GB-M1)
Q12056 1.5e-59 183 70 1 124 1 ISU2 Iron sulfur cluster assembly protein 2, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9MAB6 2.71e-58 180 70 0 123 2 ISU2 Iron-sulfur cluster assembly protein 2 Arabidopsis thaliana
Q9UTC6 1.18e-57 179 66 0 123 1 isu1 Iron sulfur cluster assembly protein 1, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B0YLW7 2.45e-57 177 67 1 122 3 ISU1 Iron sulfur cluster assembly protein 1 Trachipleistophora hominis
P0DMG2 8.92e-39 130 55 3 123 1 iscU2 Iron-sulfur cluster assembly scaffold protein IscU 2 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P0DMG1 8.92e-39 130 55 3 123 3 iscU1 Iron-sulfur cluster assembly scaffold protein IscU 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O67045 5.58e-35 121 51 3 125 1 iscU Iron-sulfur cluster assembly scaffold protein IscU Aquifex aeolicus (strain VF5)
P05343 7.8e-33 119 48 3 124 3 nifU Nitrogen fixation protein NifU Klebsiella pneumoniae
P05340 8.44e-33 119 49 3 124 1 nifU Nitrogen fixation protein NifU Azotobacter vinelandii
Q43885 1.1e-29 111 48 4 125 3 nifU Nitrogen fixation protein NifU Trichormus azollae
P20628 6.1e-29 109 47 4 125 3 nifU Nitrogen fixation protein NifU Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P23121 1.52e-28 108 46 3 122 3 nifU Nitrogen fixation protein NifU Azotobacter chroococcum mcd 1
Q43909 9.53e-26 101 47 5 126 3 nifU Nitrogen fixation protein NifU Azospirillum brasilense
Q1AWB1 3.17e-17 79 35 2 125 3 nifU/mnmA Bifunctional protein NifU/MnmA Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
O32163 9.2e-13 63 28 5 136 1 sufU Zinc-dependent sulfurtransferase SufU Bacillus subtilis (strain 168)
Q9A1G2 6.44e-11 59 35 6 145 1 iscU Iron-sulfur cluster assembly scaffold protein IscU Streptococcus pyogenes serotype M1
Q9X192 1.56e-09 55 30 6 139 3 iscU Iron-sulfur cluster assembly scaffold protein IscU Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q01180 1.2e-06 48 31 2 85 3 nifU Nitrogen fixation protein NifU Cereibacter sphaeroides

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_02485
Feature type CDS
Gene iscU
Product Fe-S cluster assembly scaffold protein IscU, NifU family
Location 98353 - 98739 (strand: 1)
Length 387 (nucleotides) / 128 (amino acids)

Contig

Accession ZDB_680
Length 282413 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_525
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01592 NifU-like N terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0822 Posttranslational modification, protein turnover, chaperones (O) O Fe-S cluster assembly scaffold protein IscU, NifU family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04488 nitrogen fixation protein NifU and related proteins - -

Protein Sequence

MAYSDKVIDHYENPRNVGSFDNEDPTVGSGMVGAPACGDVMKLQIKVDDNGVIEDARFKTYGCGSAIASSSLVTEWMKGKTLDEAEAIKNTAIAEELELPPVKIHCSILAEDAIKAAIADYKSKRRGN

Flanking regions ( +/- flanking 50bp)

CAGTATTGAATGGTCACACCATTAATCAGACGGTTTCAGGAGTATAAACAATGGCTTATAGCGATAAAGTAATCGATCACTACGAAAACCCGCGCAACGTCGGTTCATTCGACAACGAAGACCCGACTGTCGGCAGCGGCATGGTGGGTGCACCGGCCTGTGGTGACGTAATGAAGTTACAGATCAAAGTTGATGATAACGGCGTGATTGAAGACGCACGTTTCAAAACCTACGGCTGCGGCTCGGCGATTGCGTCAAGCTCACTGGTGACTGAGTGGATGAAAGGGAAGACCCTGGATGAAGCGGAAGCCATCAAAAATACCGCGATTGCGGAAGAACTGGAATTACCGCCGGTGAAAATTCACTGCTCGATTCTGGCTGAAGATGCGATCAAAGCAGCAATTGCGGATTACAAAAGTAAACGCCGGGGCAACTAATAGCCCGCCGCTGCCGGTGTGCAGCAGGTAAAACAATAAAATAATGGCGG