Homologs in group_525

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01130 FBDBKF_01130 96.9 Morganella morganii S1 iscU Fe-S cluster assembly scaffold protein IscU, NifU family
EHELCC_00415 EHELCC_00415 96.9 Morganella morganii S2 iscU Fe-S cluster assembly scaffold protein IscU, NifU family
NLDBIP_03045 NLDBIP_03045 96.9 Morganella morganii S4 iscU Fe-S cluster assembly scaffold protein IscU, NifU family
LHKJJB_04560 LHKJJB_04560 96.9 Morganella morganii S3 iscU Fe-S cluster assembly scaffold protein IscU, NifU family
HKOGLL_02485 HKOGLL_02485 96.9 Morganella morganii S5 iscU Fe-S cluster assembly scaffold protein IscU, NifU family
PMI_RS09175 PMI_RS09175 97.7 Proteus mirabilis HI4320 iscU Fe-S cluster assembly scaffold IscU

Distribution of the homologs in the orthogroup group_525

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_525

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACD7 1.43e-82 240 89 0 128 3 iscU Iron-sulfur cluster assembly scaffold protein IscU Shigella flexneri
P0ACD4 1.43e-82 240 89 0 128 1 iscU Iron-sulfur cluster assembly scaffold protein IscU Escherichia coli (strain K12)
P0ACD5 1.43e-82 240 89 0 128 3 iscU Iron-sulfur cluster assembly scaffold protein IscU Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACD6 1.43e-82 240 89 0 128 1 iscU Iron-sulfur cluster assembly scaffold protein IscU Escherichia coli O157:H7
Q57074 7.18e-77 226 84 0 125 1 iscU Iron-sulfur cluster assembly scaffold protein IscU Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O51885 1.85e-75 222 82 0 126 3 iscU Iron-sulfur cluster assembly scaffold protein IscU Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
O31270 1.04e-74 221 80 0 125 1 iscU Iron-sulfur cluster assembly scaffold protein IscU Azotobacter vinelandii
Q89A18 3.11e-73 217 82 0 126 3 nifU Iron-sulfur cluster assembly scaffold protein IscU Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P57658 3.78e-73 216 81 0 125 3 iscU Iron-sulfur cluster assembly scaffold protein IscU Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9ZD61 1.72e-69 207 75 0 128 3 iscU Iron-sulfur cluster assembly scaffold protein IscU Rickettsia prowazekii (strain Madrid E)
Q9D7P6 3.44e-66 200 73 0 126 1 Iscu Iron-sulfur cluster assembly enzyme ISCU Mus musculus
Q6CFQ0 4.35e-66 201 73 0 126 3 ISU1 Iron sulfur cluster assembly protein 1, mitochondrial Yarrowia lipolytica (strain CLIB 122 / E 150)
Q9H1K1 7.57e-66 199 73 0 126 1 ISCU Iron-sulfur cluster assembly enzyme ISCU Homo sapiens
O49627 8.52e-65 197 73 1 124 1 ISU1 Iron-sulfur cluster assembly protein 1 Arabidopsis thaliana
Q8LR34 2.99e-64 196 71 1 125 2 ISU1 Iron-sulfur cluster assembly protein 1 Oryza sativa subsp. japonica
Q6BGU0 8.77e-63 192 70 1 127 3 ISU1 Iron sulfur cluster assembly protein 1, mitochondrial Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q03020 1.43e-62 191 72 1 125 1 ISU1 Iron sulfur cluster assembly protein 1, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q6CRQ9 2.65e-62 191 71 1 124 3 ISU1 Iron sulfur cluster assembly protein 1, mitochondrial Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q75C07 3.11e-62 190 71 1 125 3 ISU1 Iron sulfur cluster assembly protein 1, mitochondrial Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
O81433 3.9e-61 187 68 0 123 2 ISU3 Iron-sulfur cluster assembly protein 3 Arabidopsis thaliana
Q6FJY3 7.71e-61 188 72 1 124 3 ISU1 Iron sulfur cluster assembly protein 1, mitochondrial Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q8SSM2 1.21e-60 185 68 0 124 3 ISU1 Iron sulfur cluster assembly protein 1 Encephalitozoon cuniculi (strain GB-M1)
Q12056 7.26e-60 184 69 1 125 1 ISU2 Iron sulfur cluster assembly protein 2, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9MAB6 3.06e-59 182 71 0 123 2 ISU2 Iron-sulfur cluster assembly protein 2 Arabidopsis thaliana
Q9UTC6 5.68e-58 180 66 0 123 1 isu1 Iron sulfur cluster assembly protein 1, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B0YLW7 1.19e-57 177 67 1 122 3 ISU1 Iron sulfur cluster assembly protein 1 Trachipleistophora hominis
P0DMG2 2.38e-38 129 54 3 123 1 iscU2 Iron-sulfur cluster assembly scaffold protein IscU 2 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P0DMG1 2.38e-38 129 54 3 123 3 iscU1 Iron-sulfur cluster assembly scaffold protein IscU 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O67045 4.65e-36 124 52 4 128 1 iscU Iron-sulfur cluster assembly scaffold protein IscU Aquifex aeolicus (strain VF5)
P05343 1.26e-33 121 49 3 124 3 nifU Nitrogen fixation protein NifU Klebsiella pneumoniae
P05340 1.64e-33 121 50 3 124 1 nifU Nitrogen fixation protein NifU Azotobacter vinelandii
P23121 2.77e-29 110 47 3 122 3 nifU Nitrogen fixation protein NifU Azotobacter chroococcum mcd 1
Q43885 4.53e-29 109 47 4 125 3 nifU Nitrogen fixation protein NifU Trichormus azollae
P20628 2.27e-28 108 46 4 125 3 nifU Nitrogen fixation protein NifU Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q43909 3.19e-25 100 46 5 126 3 nifU Nitrogen fixation protein NifU Azospirillum brasilense
Q1AWB1 1.71e-17 80 35 2 125 3 nifU/mnmA Bifunctional protein NifU/MnmA Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
O32163 1.29e-13 66 38 3 86 1 sufU Zinc-dependent sulfurtransferase SufU Bacillus subtilis (strain 168)
Q9A1G2 1.58e-10 58 34 5 135 1 iscU Iron-sulfur cluster assembly scaffold protein IscU Streptococcus pyogenes serotype M1
Q9X192 2.35e-10 57 30 5 139 3 iscU Iron-sulfur cluster assembly scaffold protein IscU Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q01180 2.21e-06 48 31 2 83 3 nifU Nitrogen fixation protein NifU Cereibacter sphaeroides

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07200
Feature type CDS
Gene iscU
Product Fe-S cluster assembly scaffold IscU
Location 1498352 - 1498738 (strand: -1)
Length 387 (nucleotides) / 128 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_525
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01592 NifU-like N terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0822 Posttranslational modification, protein turnover, chaperones (O) O Fe-S cluster assembly scaffold protein IscU, NifU family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04488 nitrogen fixation protein NifU and related proteins - -

Protein Sequence

MAYSEKVIDHYENPRNVGSFDNEDPTVGSGMVGAPACGDVMKLQIKVDDNGVIEDARFKTYGCGSAIASSSLVTEWMKGKTLDEAESIKNTAIAEELELPPVKIHCSILAEDAIKAAIADYKSKRQGK

Flanking regions ( +/- flanking 50bp)

CAGTATTGAATGGTCACACCATTAATCAGACGGTTTCAGGAGCATAAACAATGGCTTATAGCGAAAAAGTAATCGATCACTACGAAAATCCGCGCAACGTGGGCTCTTTTGATAACGAAGATCCGACAGTCGGCAGCGGCATGGTGGGTGCACCGGCCTGTGGTGACGTCATGAAACTGCAGATCAAAGTTGATGATAACGGCGTAATTGAAGATGCCCGTTTCAAAACTTACGGTTGCGGCTCTGCAATTGCCTCCAGCTCGCTGGTGACAGAGTGGATGAAAGGGAAAACCCTGGATGAAGCTGAGTCCATCAAAAATACCGCTATTGCGGAAGAGTTAGAATTACCGCCGGTGAAAATTCACTGCTCAATTCTGGCTGAAGATGCGATTAAAGCAGCAATTGCGGATTACAAAAGTAAGCGCCAGGGCAAATAATAGCCCCCGTTATCACTGAGTGCAGGGATGTGAATTCCTGCTGTTCAGAT