Homologs in group_629

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02030 FBDBKF_02030 100.0 Morganella morganii S1 cmoA carboxy-S-adenosyl-L-methionine synthase CmoA
EHELCC_02500 EHELCC_02500 100.0 Morganella morganii S2 cmoA carboxy-S-adenosyl-L-methionine synthase CmoA
NLDBIP_00960 NLDBIP_00960 100.0 Morganella morganii S4 cmoA carboxy-S-adenosyl-L-methionine synthase CmoA
LHKJJB_01075 LHKJJB_01075 100.0 Morganella morganii S3 cmoA carboxy-S-adenosyl-L-methionine synthase CmoA
F4V73_RS04395 F4V73_RS04395 91.2 Morganella psychrotolerans cmoA carboxy-S-adenosyl-L-methionine synthase CmoA
PMI_RS05380 PMI_RS05380 76.7 Proteus mirabilis HI4320 cmoA carboxy-S-adenosyl-L-methionine synthase CmoA

Distribution of the homologs in the orthogroup group_629

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_629

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B5XPZ6 1.67e-141 399 76 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Klebsiella pneumoniae (strain 342)
C0Q2E4 6.24e-141 398 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella paratyphi C (strain RKS4594)
Q57N92 6.24e-141 398 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella choleraesuis (strain SC-B67)
B7NBM1 1.81e-140 397 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q83KQ5 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella flexneri
Q0T3Q8 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella flexneri serotype 5b (strain 8401)
Q32H79 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q1RAR4 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain UTI89 / UPEC)
B1LD01 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain SMS-3-5 / SECEC)
B6I1E8 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain SE11)
B1J0L8 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FGQ6 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGW2 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AC31 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O1:K1 / APEC
A8A171 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O9:H4 (strain HS)
B7M2G1 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O8 (strain IAI1)
B7MW64 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O81 (strain ED1a)
B5YR15 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCH6 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O157:H7
B7L7S3 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain 55989 / EAEC)
B7MBS9 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZMZ5 3.52e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LPH4 3.89e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B4ETP1 4.18e-140 396 78 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Proteus mirabilis (strain HI4320)
P76290 5.77e-140 395 77 1 240 1 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain K12)
B1XHD8 5.77e-140 395 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain K12 / DH10B)
C4ZQF4 5.77e-140 395 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain K12 / MC4100 / BW2952)
A6TB39 9.24e-140 395 75 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A9MUB4 1.23e-139 395 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B7USP7 1.4e-139 394 76 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B2U4X1 2.25e-139 394 76 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q322I9 3.09e-139 394 76 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella boydii serotype 4 (strain Sb227)
B7NS48 3.26e-139 394 76 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q3Z2P6 3.76e-139 394 76 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella sonnei (strain Ss046)
Q7CQC4 4.84e-139 393 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFX8 4.84e-139 393 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella typhi
B5BH50 4.84e-139 393 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella paratyphi A (strain AKU_12601)
Q5PMY8 4.84e-139 393 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5FSM6 4.84e-139 393 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella dublin (strain CT_02021853)
B5F3I5 4.84e-139 393 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella agona (strain SL483)
A7MEB1 5e-139 393 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Cronobacter sakazakii (strain ATCC BAA-894)
B4TYS8 5.05e-139 393 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella schwarzengrund (strain CVM19633)
B4SVF5 5.05e-139 393 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella newport (strain SL254)
B4T803 5.05e-139 393 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella heidelberg (strain SL476)
B5R8D2 5.05e-139 393 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R146 5.05e-139 393 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella enteritidis PT4 (strain P125109)
A9MNC8 8.27e-139 392 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4WBM7 8.8e-138 390 76 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Enterobacter sp. (strain 638)
Q7N555 2.12e-137 389 72 1 249 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8AFH1 2.88e-137 389 75 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B1JLL8 6.95e-135 384 72 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TJK8 6.95e-135 384 72 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pestis (strain Pestoides F)
Q1CJH3 6.95e-135 384 72 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYY1 6.95e-135 384 72 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pestis bv. Antiqua (strain Angola)
Q7CIB7 6.95e-135 384 72 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pestis
Q1C823 6.95e-135 384 72 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FID3 6.95e-135 384 72 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q66AU7 6.95e-135 384 72 1 248 3 cmoA2 Carboxy-S-adenosyl-L-methionine synthase 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K316 6.95e-135 384 72 1 248 3 cmoA2 Carboxy-S-adenosyl-L-methionine synthase 2 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A1JRM2 3.32e-134 382 73 2 245 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GFJ7 4.85e-134 380 74 1 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Serratia proteamaculans (strain 568)
B2VJC2 1.17e-131 374 72 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6D483 8.46e-128 365 71 1 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B8F3G3 1.25e-123 354 69 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Glaesserella parasuis serovar 5 (strain SH0165)
P43985 4.92e-123 352 68 1 240 1 cmoA Carboxy-S-adenosyl-L-methionine synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CM57 8.79e-123 352 67 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pasteurella multocida (strain Pm70)
A3N0B6 2.46e-122 350 69 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q2NTJ7 2.66e-122 351 67 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Sodalis glossinidius (strain morsitans)
Q4QNL9 2.75e-122 350 69 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Haemophilus influenzae (strain 86-028NP)
A5UGD5 7.12e-122 349 68 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Haemophilus influenzae (strain PittGG)
C3LLL0 1.31e-121 349 67 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio cholerae serotype O1 (strain M66-2)
Q9KSU2 1.31e-121 349 67 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F278 1.31e-121 349 67 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A6VQB0 1.95e-121 348 68 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B3GXJ0 2.01e-121 348 68 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q65UP7 6.72e-121 347 67 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0BP33 1.8e-120 346 68 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A5UAG5 1.94e-120 346 67 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Haemophilus influenzae (strain PittEE)
B0USU1 4.5e-119 342 67 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Histophilus somni (strain 2336)
Q0I3S4 1.18e-118 341 67 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Histophilus somni (strain 129Pt)
Q6LT55 1.56e-118 341 66 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Photobacterium profundum (strain SS9)
Q7VLX6 4.82e-118 340 66 1 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q87QV4 5.77e-116 335 65 1 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7N1I9 6.37e-116 335 65 1 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio campbellii (strain ATCC BAA-1116)
A4SPN7 8.5e-116 334 63 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aeromonas salmonicida (strain A449)
Q8DAN9 1.16e-115 334 64 1 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio vulnificus (strain CMCP6)
Q7MJ72 1.1e-114 332 64 1 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio vulnificus (strain YJ016)
Q5E6A3 4.14e-114 330 63 2 245 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A0KIF6 4.89e-114 330 63 1 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B5FCP8 1.98e-113 328 63 2 245 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aliivibrio fischeri (strain MJ11)
B7VMH8 3.5e-113 327 63 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio atlanticus (strain LGP32)
B6EGJ0 1.67e-112 326 62 2 245 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aliivibrio salmonicida (strain LFI1238)
C4K5W2 4.84e-110 320 65 0 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A8FUW4 1.07e-104 306 60 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella sediminis (strain HAW-EB3)
B1KHG9 1.57e-103 303 60 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella woodyi (strain ATCC 51908 / MS32)
A8H551 2.19e-101 298 58 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A4Y6S3 1.71e-100 295 58 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A3QEP9 1.87e-100 295 57 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B8CNX5 2.24e-99 293 57 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
A9L3I3 2.81e-99 292 58 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella baltica (strain OS195)
A6WNQ8 2.81e-99 292 58 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella baltica (strain OS185)
A3D475 2.81e-99 292 58 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A1RJQ8 3.35e-99 292 58 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella sp. (strain W3-18-1)
B8EA69 7.2e-99 291 58 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella baltica (strain OS223)
Q8EEE7 1.1e-98 291 58 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HUY5 5.5e-98 289 58 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella sp. (strain MR-7)
Q0HIZ7 6.62e-98 289 58 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella sp. (strain MR-4)
A0KWL3 6.62e-98 289 58 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella sp. (strain ANA-3)
B0TSA1 1e-97 288 54 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella halifaxensis (strain HAW-EB4)
Q483C9 9.97e-97 286 56 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q081N3 2.49e-96 285 57 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella frigidimarina (strain NCIMB 400)
Q12N04 1.06e-95 283 55 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1S6P4 3.22e-95 282 57 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q5R0Q6 5.45e-94 279 50 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A1SST5 1.24e-92 275 55 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
C6E228 1.46e-92 275 55 2 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Geobacter sp. (strain M21)
B3E6X7 6.31e-92 274 55 2 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q3IIQ4 2.12e-91 272 53 2 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudoalteromonas translucida (strain TAC 125)
Q88MX7 9.81e-91 271 54 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W8E4 1.62e-90 270 54 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B5EIQ7 2.42e-90 270 54 2 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B3PFU2 1.21e-89 268 52 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Cellvibrio japonicus (strain Ueda107)
B0KV19 1.33e-89 268 53 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas putida (strain GB-1)
Q31JJ7 2.28e-89 268 52 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q1I5M8 7.4e-89 266 53 3 252 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas entomophila (strain L48)
A4VIY2 8.72e-89 266 52 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Stutzerimonas stutzeri (strain A1501)
B1J4E5 7.25e-88 263 52 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas putida (strain W619)
Q15NL2 1.29e-87 263 49 2 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q39SM1 5.51e-87 261 52 2 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B4S0J8 9.31e-87 261 51 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q4K6X7 2.46e-86 259 52 3 252 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3K7D5 3.45e-86 259 52 3 252 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas fluorescens (strain Pf0-1)
Q21JL6 1.16e-85 258 50 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q9I5G3 1.41e-85 258 51 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02HS7 1.41e-85 258 51 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
C3K6Z4 3.13e-85 257 52 3 252 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas fluorescens (strain SBW25)
C1DQT0 5.83e-85 256 51 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q87XG6 1.05e-83 253 50 3 252 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A6VAK1 1.34e-83 253 51 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas aeruginosa (strain PA7)
Q4ZPE6 1.71e-82 250 49 3 252 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas syringae pv. syringae (strain B728a)
Q48EV8 3.19e-82 249 49 3 252 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A4XSD1 3.93e-82 249 51 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas mendocina (strain ymp)
Q2SJW0 5.26e-77 236 47 2 246 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Hahella chejuensis (strain KCTC 2396)
A1U4B8 3.46e-76 234 47 3 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q1QUG4 4.14e-76 234 47 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0VQX7 6.25e-74 228 47 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A5WC54 1.56e-62 200 42 3 253 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Psychrobacter sp. (strain PRwf-1)
Q4FQB1 5.98e-62 198 42 4 259 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A1AXI6 6.03e-62 197 43 2 229 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Ruthia magnifica subsp. Calyptogena magnifica
Q1Q8I4 1.13e-61 197 41 3 259 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q3A8E8 1.07e-59 192 37 0 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A5EVQ4 2.83e-58 188 42 4 246 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Dichelobacter nodosus (strain VCS1703A)
C0QJG8 9.01e-56 182 40 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q6AIL1 4.72e-51 169 37 2 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A8EVV4 9.12e-49 163 34 3 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aliarcobacter butzleri (strain RM4018)
Q605H3 2.56e-46 157 34 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A0RPY4 1.28e-45 155 34 3 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter fetus subsp. fetus (strain 82-40)
Q30T90 3.32e-45 154 35 3 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q3J7D1 5.52e-45 154 35 2 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q7MSC3 4.08e-43 149 36 5 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B9L9I3 8.53e-43 148 33 5 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
A7GXS7 1.13e-42 148 34 4 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter curvus (strain 525.92)
A6Q7G6 4.64e-42 146 32 3 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Sulfurovum sp. (strain NBC37-1)
A6Q429 6.22e-42 146 34 4 245 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Nitratiruptor sp. (strain SB155-2)
A7I232 1.65e-40 142 32 3 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A7ZED5 1.87e-39 139 35 3 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter concisus (strain 13826)
B9KG20 8.84e-39 138 30 3 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A1VYV0 1.71e-38 137 33 3 227 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q5HVI0 6.25e-38 135 33 3 227 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter jejuni (strain RM1221)
Q0PAS7 6.25e-38 135 33 3 227 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q17YM3 7.02e-38 135 34 4 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter acinonychis (strain Sheeba)
A8FL14 1.03e-37 135 33 3 227 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A7H3U1 1.09e-37 135 33 3 227 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
B2UUH2 1.57e-37 135 33 4 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain Shi470)
Q7VF27 2.33e-37 134 32 4 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q9ZKE5 8.19e-37 133 32 4 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain J99 / ATCC 700824)
B6JMQ6 9.02e-37 133 32 4 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain P12)
Q1CSK1 3.48e-36 131 33 5 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain HPAG1)
O25150 4.07e-36 131 32 4 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain ATCC 700392 / 26695)
B5Z863 4.4e-36 131 33 5 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain G27)
Q119M3 2.26e-35 129 31 3 234 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Trichodesmium erythraeum (strain IMS101)
Q5HMV4 8.02e-33 122 31 4 227 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q66B88 1.69e-21 92 27 5 241 3 cmoA1 Carboxy-S-adenosyl-L-methionine synthase 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K217 1.69e-21 92 27 5 241 3 cmoA1 Carboxy-S-adenosyl-L-methionine synthase 1 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
P20187 4.78e-08 56 31 6 158 3 None Uncharacterized 37.1 kDa protein in transposon TN4556 Streptomyces fradiae
Q88SI6 2.34e-05 47 27 9 193 3 menG Demethylmenaquinone methyltransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B2IAI0 4.07e-05 47 27 4 107 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Xylella fastidiosa (strain M23)
A1K8U5 4.36e-05 47 28 4 116 3 tam Trans-aconitate 2-methyltransferase Azoarcus sp. (strain BH72)
E5KIC0 0.000118 45 30 4 110 1 cypM Cypemycin N-terminal methyltransferase Streptomyces sp.
D5DIV9 0.000276 45 25 6 143 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Priestia megaterium (strain DSM 319 / IMG 1521)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_01115
Feature type CDS
Gene cmoA
Product carboxy-S-adenosyl-L-methionine synthase CmoA
Location 201059 - 201823 (strand: -1)
Length 765 (nucleotides) / 254 (amino acids)

Contig

Accession ZDB_679
Length 398279 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_629
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13649 Methyltransferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4106 Energy production and conversion (C) C Trans-aconitate methyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15256 tRNA (cmo5U34)-methyltransferase [EC:2.1.1.-] - -

Protein Sequence

MSKEIPNPPQDTLFAAPIARLGDWTFDEKVADVFPDMIKRSIPGYSNIIAMIGMLAGRFVTPGSQVYDLGCSRAAATLSIRPNIADKPGCRIIAVDNSAPMVEHARRHVESYKSPVPVEVTEGDIRHIAIENASMVVLNFTLQFLAPDDRAALLKKIYQGLLPGGVLVLSEKFSFEDEQIGDLLFSMHHDFKRANGYSELEISQKRTMLEDVMLTDSVETHKSRLKAAGFEHCEVWFQCFNFGSLLAVKENNHD

Flanking regions ( +/- flanking 50bp)

GGTCACCTCTGTTAGAATGCGCGCATCTTTTTGTATTGCAGATCTGTGTTATGTCCAAAGAAATTCCGAATCCGCCGCAGGATACTCTGTTCGCGGCACCGATTGCCCGTCTTGGTGACTGGACGTTTGATGAGAAAGTCGCGGATGTGTTTCCCGATATGATCAAACGCTCAATTCCGGGCTACTCCAATATTATTGCCATGATTGGCATGCTGGCCGGCCGTTTTGTCACGCCCGGCAGTCAGGTTTATGATCTCGGCTGTTCCCGCGCTGCCGCCACCCTGTCTATCCGCCCGAATATCGCGGATAAGCCCGGCTGCCGGATCATCGCCGTGGATAATTCCGCACCGATGGTGGAACACGCCCGCCGCCATGTGGAAAGTTATAAATCCCCGGTACCGGTTGAGGTAACCGAAGGCGATATCCGCCATATTGCGATTGAGAATGCCTCGATGGTGGTTCTCAATTTTACCCTGCAATTCCTGGCACCGGATGACCGCGCCGCACTGCTGAAAAAAATCTATCAGGGCCTGCTGCCGGGCGGCGTGCTGGTGTTATCGGAAAAATTCAGTTTTGAGGATGAGCAGATCGGCGATTTGCTGTTCAGCATGCACCACGATTTCAAACGTGCCAACGGCTACAGTGAGCTGGAAATCAGCCAGAAACGCACCATGCTGGAAGATGTCATGCTGACCGACAGTGTGGAAACCCACAAATCACGGCTGAAAGCGGCCGGTTTTGAACATTGTGAAGTCTGGTTCCAGTGCTTTAACTTCGGGTCATTACTGGCAGTGAAAGAGAATAACCATGATTGATTTCGGCAATTTTTATCAGTTAATTGCAAAAAATGAGCGCCTGAGCCACT