Homologs in group_702

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02030 FBDBKF_02030 76.7 Morganella morganii S1 cmoA carboxy-S-adenosyl-L-methionine synthase CmoA
EHELCC_02500 EHELCC_02500 76.7 Morganella morganii S2 cmoA carboxy-S-adenosyl-L-methionine synthase CmoA
NLDBIP_00960 NLDBIP_00960 76.7 Morganella morganii S4 cmoA carboxy-S-adenosyl-L-methionine synthase CmoA
LHKJJB_01075 LHKJJB_01075 76.7 Morganella morganii S3 cmoA carboxy-S-adenosyl-L-methionine synthase CmoA
HKOGLL_01115 HKOGLL_01115 76.7 Morganella morganii S5 cmoA carboxy-S-adenosyl-L-methionine synthase CmoA
F4V73_RS04395 F4V73_RS04395 77.9 Morganella psychrotolerans cmoA carboxy-S-adenosyl-L-methionine synthase CmoA

Distribution of the homologs in the orthogroup group_702

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_702

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4ETP1 0.0 520 100 0 249 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Proteus mirabilis (strain HI4320)
Q7N555 6.31e-157 438 83 1 249 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JLL8 2.28e-153 430 81 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TJK8 2.28e-153 430 81 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pestis (strain Pestoides F)
Q1CJH3 2.28e-153 430 81 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYY1 2.28e-153 430 81 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pestis bv. Antiqua (strain Angola)
Q7CIB7 2.28e-153 430 81 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pestis
Q1C823 2.28e-153 430 81 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FID3 2.28e-153 430 81 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q66AU7 2.28e-153 430 81 1 248 3 cmoA2 Carboxy-S-adenosyl-L-methionine synthase 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K316 2.28e-153 430 81 1 248 3 cmoA2 Carboxy-S-adenosyl-L-methionine synthase 2 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A1JRM2 2.8e-153 430 81 1 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8AFH1 1.86e-150 422 82 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4WBM7 2.93e-150 421 81 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Enterobacter sp. (strain 638)
B7LPH4 1.78e-149 419 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q83KQ5 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella flexneri
Q0T3Q8 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella flexneri serotype 5b (strain 8401)
Q32H79 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q1RAR4 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain UTI89 / UPEC)
B1LD01 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain SMS-3-5 / SECEC)
B6I1E8 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain SE11)
B1J0L8 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FGQ6 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGW2 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AC31 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O1:K1 / APEC
A8A171 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O9:H4 (strain HS)
B7M2G1 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O8 (strain IAI1)
B7MW64 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O81 (strain ED1a)
B5YR15 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCH6 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O157:H7
B7L7S3 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain 55989 / EAEC)
B7MBS9 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZMZ5 7.98e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3Z2P6 8.07e-149 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella sonnei (strain Ss046)
B5XPZ6 9.94e-149 417 79 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Klebsiella pneumoniae (strain 342)
B7NBM1 1.11e-148 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P76290 1.44e-148 417 80 0 241 1 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain K12)
B1XHD8 1.44e-148 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain K12 / DH10B)
C4ZQF4 1.44e-148 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7NS48 1.49e-148 417 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A7MEB1 1.9e-148 417 81 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Cronobacter sakazakii (strain ATCC BAA-894)
A8GFJ7 2.36e-148 416 81 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Serratia proteamaculans (strain 568)
B7USP7 3.07e-148 416 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q322I9 3.39e-148 416 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella boydii serotype 4 (strain Sb227)
C0Q2E4 4.13e-148 416 80 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella paratyphi C (strain RKS4594)
Q57N92 4.13e-148 416 80 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella choleraesuis (strain SC-B67)
B2U4X1 4.27e-148 416 80 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A6TB39 6.41e-148 416 79 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q7CQC4 5.61e-147 413 80 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFX8 5.61e-147 413 80 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella typhi
B5BH50 5.61e-147 413 80 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella paratyphi A (strain AKU_12601)
Q5PMY8 5.61e-147 413 80 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5FSM6 5.61e-147 413 80 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella dublin (strain CT_02021853)
B5F3I5 5.61e-147 413 80 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella agona (strain SL483)
A9MUB4 6.91e-147 413 80 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TYS8 2.07e-146 412 79 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella schwarzengrund (strain CVM19633)
B4SVF5 2.07e-146 412 79 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella newport (strain SL254)
B4T803 2.07e-146 412 79 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella heidelberg (strain SL476)
B5R8D2 2.07e-146 412 79 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R146 2.07e-146 412 79 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella enteritidis PT4 (strain P125109)
A9MNC8 3.21e-146 411 79 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q6D483 2.6e-144 406 79 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2VJC2 2.62e-144 406 78 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NTJ7 1.11e-137 389 75 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Sodalis glossinidius (strain morsitans)
Q6LT55 3.19e-130 370 70 0 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Photobacterium profundum (strain SS9)
C3LLL0 1.02e-127 364 70 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio cholerae serotype O1 (strain M66-2)
Q9KSU2 1.02e-127 364 70 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F278 1.02e-127 364 70 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q5E6A3 2.05e-125 358 68 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q87QV4 4.38e-124 355 67 1 245 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B5FCP8 5.47e-124 355 67 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aliivibrio fischeri (strain MJ11)
A7N1I9 8.44e-124 354 67 1 245 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio campbellii (strain ATCC BAA-1116)
B6EGJ0 1.03e-123 354 67 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aliivibrio salmonicida (strain LFI1238)
Q7MJ72 1.98e-123 353 68 1 245 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio vulnificus (strain YJ016)
Q8DAN9 4.61e-123 352 68 1 245 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio vulnificus (strain CMCP6)
B7VMH8 3.92e-122 350 64 1 247 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio atlanticus (strain LGP32)
P43985 8.3e-121 347 68 0 239 1 cmoA Carboxy-S-adenosyl-L-methionine synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B8F3G3 1.18e-120 346 67 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Glaesserella parasuis serovar 5 (strain SH0165)
Q4QNL9 2.22e-120 345 68 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Haemophilus influenzae (strain 86-028NP)
A3N0B6 4.89e-120 345 67 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B3GXJ0 9.33e-120 344 67 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A5UGD5 1.15e-119 343 67 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Haemophilus influenzae (strain PittGG)
Q9CM57 1.58e-119 343 65 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pasteurella multocida (strain Pm70)
B0BP33 7.31e-119 342 67 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A5UAG5 7.55e-119 342 67 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Haemophilus influenzae (strain PittEE)
Q65UP7 1.12e-117 338 67 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VQB0 1.64e-117 338 67 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0USU1 8.1e-117 337 67 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Histophilus somni (strain 2336)
Q0I3S4 2.1e-116 335 67 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Histophilus somni (strain 129Pt)
Q7VLX6 1.48e-114 331 65 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C4K5W2 3.72e-113 328 66 1 246 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A4SPN7 5.87e-113 327 62 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aeromonas salmonicida (strain A449)
A0KIF6 1.12e-112 326 61 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A8FUW4 2.56e-108 315 60 0 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella sediminis (strain HAW-EB3)
B1KHG9 9.02e-108 313 60 0 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella woodyi (strain ATCC 51908 / MS32)
A4Y6S3 9.63e-108 313 61 0 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q483C9 9.97e-108 313 61 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1RJQ8 3e-107 312 61 0 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella sp. (strain W3-18-1)
B8CNX5 3.43e-107 312 59 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
A9L3I3 6.05e-107 311 61 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella baltica (strain OS195)
A6WNQ8 6.05e-107 311 61 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella baltica (strain OS185)
A3D475 6.05e-107 311 61 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EA69 1.83e-106 310 61 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella baltica (strain OS223)
A8H551 3.48e-106 310 59 0 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A3QEP9 9.85e-106 308 58 0 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q8EEE7 1.53e-105 308 61 0 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HIZ7 6.39e-105 306 60 0 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella sp. (strain MR-4)
A0KWL3 6.39e-105 306 60 0 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella sp. (strain ANA-3)
Q0HUY5 3.97e-104 304 60 0 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella sp. (strain MR-7)
B0TSA1 6.79e-104 304 57 0 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella halifaxensis (strain HAW-EB4)
Q12N04 8.63e-102 298 57 0 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1SST5 2.1e-100 295 58 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q081N3 2.99e-99 292 57 0 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella frigidimarina (strain NCIMB 400)
B3PFU2 1.36e-98 290 55 1 247 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Cellvibrio japonicus (strain Ueda107)
A1S6P4 3.18e-98 290 58 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B4S0J8 6.19e-98 289 55 0 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B3E6X7 1.87e-97 288 56 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q15NL2 5.88e-97 286 53 1 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q1I5M8 7.03e-97 286 56 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas entomophila (strain L48)
A4XSD1 1.11e-96 286 56 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas mendocina (strain ymp)
C6E228 2.38e-96 285 57 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Geobacter sp. (strain M21)
A4VIY2 7.45e-96 283 54 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Stutzerimonas stutzeri (strain A1501)
Q5R0Q6 1.61e-95 283 51 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q3IIQ4 4.3e-95 281 54 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudoalteromonas translucida (strain TAC 125)
Q9I5G3 8.8e-95 281 56 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02HS7 8.8e-95 281 56 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q21JL6 9.59e-95 281 54 0 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B5EIQ7 1.47e-94 280 56 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B0KV19 4.11e-94 279 54 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas putida (strain GB-1)
Q3K7D5 5e-94 279 55 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas fluorescens (strain Pf0-1)
Q88MX7 6.87e-94 278 54 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W8E4 9.42e-94 278 54 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A6VAK1 1.33e-93 278 54 1 247 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas aeruginosa (strain PA7)
C3K6Z4 5.41e-93 276 55 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas fluorescens (strain SBW25)
Q31JJ7 5.92e-93 276 53 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q4K6X7 1.43e-92 275 54 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B1J4E5 7.13e-92 273 53 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas putida (strain W619)
C1DQT0 6.76e-91 271 52 2 246 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q87XG6 2.65e-90 270 53 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48EV8 2.83e-90 270 52 1 245 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZPE6 7.01e-89 266 51 1 245 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas syringae pv. syringae (strain B728a)
Q39SM1 4.06e-88 264 53 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A1U4B8 1.12e-85 258 51 2 249 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q2SJW0 1.35e-83 253 50 2 252 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Hahella chejuensis (strain KCTC 2396)
Q1QUG4 3.73e-81 247 47 0 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0VQX7 1.78e-74 229 48 0 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1AXI6 1.65e-73 226 46 2 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Ruthia magnifica subsp. Calyptogena magnifica
Q4FQB1 1.1e-65 207 41 2 258 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A5WC54 2.92e-65 207 43 2 250 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Psychrobacter sp. (strain PRwf-1)
Q1Q8I4 7.89e-65 205 40 1 255 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q3A8E8 2.9e-64 203 40 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A5EVQ4 4.13e-62 197 42 4 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Dichelobacter nodosus (strain VCS1703A)
C0QJG8 1.29e-57 186 40 0 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q605H3 3.04e-54 177 37 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q6AIL1 6.73e-53 174 38 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A8EVV4 5.08e-52 172 35 3 238 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aliarcobacter butzleri (strain RM4018)
Q7MSC3 3.74e-50 167 35 3 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B9L9I3 3.18e-49 164 34 4 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
A0RPY4 2.85e-48 162 33 4 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter fetus subsp. fetus (strain 82-40)
A6Q7G6 1.53e-47 160 35 3 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Sulfurovum sp. (strain NBC37-1)
Q3J7D1 4.87e-46 157 35 2 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q30T90 1.82e-45 155 35 3 238 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A6Q429 4.11e-45 154 35 3 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Nitratiruptor sp. (strain SB155-2)
A7GXS7 4.72e-45 154 35 3 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter curvus (strain 525.92)
A7ZED5 1.09e-43 150 37 3 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter concisus (strain 13826)
A1VYV0 6.26e-43 148 35 3 225 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q5HVI0 1.25e-42 147 35 3 225 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter jejuni (strain RM1221)
Q0PAS7 1.25e-42 147 35 3 225 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FL14 4.07e-42 146 35 3 225 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A7H3U1 4.73e-42 146 35 3 225 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q7VF27 1.21e-41 145 33 5 245 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
B9KG20 6.21e-41 143 31 4 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A7I232 1.26e-40 142 33 3 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q17YM3 1.27e-38 137 34 5 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter acinonychis (strain Sheeba)
Q119M3 2e-37 134 31 3 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Trichodesmium erythraeum (strain IMS101)
B2UUH2 7.03e-37 133 33 4 227 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain Shi470)
O25150 1.81e-36 132 33 4 231 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain ATCC 700392 / 26695)
Q1CSK1 1.22e-35 129 33 4 231 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain HPAG1)
B5Z863 1.37e-35 129 33 5 231 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain G27)
Q5HMV4 1.78e-35 129 32 3 226 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B6JMQ6 2.59e-35 129 32 3 231 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain P12)
Q9ZKE5 3.28e-35 129 32 3 231 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain J99 / ATCC 700824)
Q66B88 5.78e-27 107 30 8 244 3 cmoA1 Carboxy-S-adenosyl-L-methionine synthase 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K217 5.78e-27 107 30 8 244 3 cmoA1 Carboxy-S-adenosyl-L-methionine synthase 1 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A6LRN8 1.58e-06 51 23 4 159 3 prmA Ribosomal protein L11 methyltransferase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q88SI6 2.7e-06 50 26 11 241 3 menG Demethylmenaquinone methyltransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q86BS6 3.1e-06 50 27 3 115 1 Mettl2 tRNA N(3)-methylcytidine methyltransferase Mettl2 Drosophila melanogaster
Q875K1 3.32e-06 50 28 3 112 3 ERG6 Sterol 24-C-methyltransferase Clavispora lusitaniae (strain ATCC 42720)
Q6BRB7 5.94e-06 50 24 4 128 3 ERG6 Sterol 24-C-methyltransferase Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
O74198 2.41e-05 48 27 3 107 1 ERG6 Sterol 24-C-methyltransferase Candida albicans (strain SC5314 / ATCC MYA-2876)
Q6FRZ7 8.94e-05 46 24 3 106 3 ERG6 Sterol 24-C-methyltransferase Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
B6IAS2 0.00014 45 32 5 104 3 tam Trans-aconitate 2-methyltransferase Escherichia coli (strain SE11)
Q83RE0 0.000145 45 32 5 104 3 tam Trans-aconitate 2-methyltransferase Shigella flexneri
B7LZC1 0.000159 45 32 5 104 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O8 (strain IAI1)
A7ZLX5 0.000159 45 32 5 104 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32G05 0.000164 45 32 5 104 3 tam Trans-aconitate 2-methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
B5Z1X6 0.00017 45 32 5 104 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAZ2 0.00017 45 32 5 104 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O157:H7
Q0T4L2 0.000178 45 32 5 104 3 tam Trans-aconitate 2-methyltransferase Shigella flexneri serotype 5b (strain 8401)
P76145 0.000214 45 31 5 104 1 tam Trans-aconitate 2-methyltransferase Escherichia coli (strain K12)
B1IRU1 0.000214 45 31 5 104 3 tam Trans-aconitate 2-methyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XEA7 0.000214 45 31 5 104 3 tam Trans-aconitate 2-methyltransferase Escherichia coli (strain K12 / DH10B)
C4ZWT6 0.000214 45 31 5 104 3 tam Trans-aconitate 2-methyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7L7L9 0.000224 45 32 5 104 3 tam Trans-aconitate 2-methyltransferase Escherichia coli (strain 55989 / EAEC)
Q8TJK1 0.000236 45 27 4 118 1 arsM Arsenite methyltransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q759S7 0.000407 44 24 3 112 3 ERG6 Sterol 24-C-methyltransferase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q6C2D9 0.000511 44 25 3 112 3 ERG6 Sterol 24-C-methyltransferase Yarrowia lipolytica (strain CLIB 122 / E 150)
P20187 0.000642 43 29 4 119 3 None Uncharacterized 37.1 kDa protein in transposon TN4556 Streptomyces fradiae
Q08641 0.00073 44 22 5 170 1 ABP140 tRNA(Thr) (cytosine(32)-N(3))-methyltransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05380
Feature type CDS
Gene cmoA
Product carboxy-S-adenosyl-L-methionine synthase CmoA
Location 1178163 - 1178912 (strand: -1)
Length 750 (nucleotides) / 249 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_702
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13649 Methyltransferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4106 Energy production and conversion (C) C Trans-aconitate methyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15256 tRNA (cmo5U34)-methyltransferase [EC:2.1.1.-] - -

Protein Sequence

MSNSKSAPQDNLFATPIANLGDWRFDEKVAEVFPDMIKRSVPGYSNIISMIGMLAGRFVTPHSQVYDLGCSLGAATLSMRRNIDVAGCKIIGVDNSPAMVERCQRHIDAYKAATPVEIIEGDILDIDINNASMVVLNFTLQFLAPDNRQRLLNRIYQGLNPGGVLVLSEKFSFQDKQIGELLFNMHHDFKRANGYSELEISQKRSMLENVMLTDPVETHKSRLHQAGFPHAEVWFQCFNFGSLLAIKGE

Flanking regions ( +/- flanking 50bp)

CGCTTCTGGTAGAATACCCGCTTCTTTTATTCTTTAAGTCTATTTTAGTTATGTCTAATTCAAAATCAGCACCACAAGACAACTTATTTGCGACACCTATTGCTAATCTTGGTGACTGGCGCTTTGATGAAAAAGTCGCTGAAGTGTTCCCTGATATGATCAAACGCTCAGTGCCCGGTTACTCCAATATTATTTCCATGATAGGCATGTTAGCGGGTCGTTTTGTCACCCCTCACAGCCAAGTTTATGACTTAGGATGTTCGTTAGGTGCTGCTACCCTTTCCATGCGTCGTAATATCGATGTAGCGGGATGTAAAATTATTGGTGTTGATAATTCACCTGCGATGGTTGAGCGTTGTCAACGTCATATTGATGCTTATAAAGCAGCAACACCCGTTGAAATTATTGAAGGCGATATCCTTGATATTGACATTAATAATGCCTCGATGGTTGTCCTTAATTTCACCTTACAATTTTTAGCCCCTGATAATCGCCAAAGATTATTAAATCGAATTTACCAAGGGTTAAATCCTGGTGGGGTTTTAGTGTTATCAGAAAAATTCAGTTTTCAAGATAAACAAATTGGTGAATTACTGTTTAATATGCACCACGACTTTAAACGTGCTAATGGCTACAGTGAATTAGAGATTAGTCAAAAACGTAGTATGTTAGAAAATGTGATGCTCACTGATCCTGTTGAAACACATAAATCACGCTTACATCAAGCAGGTTTTCCTCATGCTGAAGTTTGGTTCCAATGTTTTAATTTTGGCTCTCTGTTAGCCATTAAAGGCGAATAATCATGATAAATTTTAGCTCATTTTATCAACATATTGCGCAAGATGAACGG