Homologs in group_702

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02030 FBDBKF_02030 91.2 Morganella morganii S1 cmoA carboxy-S-adenosyl-L-methionine synthase CmoA
EHELCC_02500 EHELCC_02500 91.2 Morganella morganii S2 cmoA carboxy-S-adenosyl-L-methionine synthase CmoA
NLDBIP_00960 NLDBIP_00960 91.2 Morganella morganii S4 cmoA carboxy-S-adenosyl-L-methionine synthase CmoA
LHKJJB_01075 LHKJJB_01075 91.2 Morganella morganii S3 cmoA carboxy-S-adenosyl-L-methionine synthase CmoA
HKOGLL_01115 HKOGLL_01115 91.2 Morganella morganii S5 cmoA carboxy-S-adenosyl-L-methionine synthase CmoA
PMI_RS05380 PMI_RS05380 77.9 Proteus mirabilis HI4320 cmoA carboxy-S-adenosyl-L-methionine synthase CmoA

Distribution of the homologs in the orthogroup group_702

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_702

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B5XPZ6 1.23e-145 410 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Klebsiella pneumoniae (strain 342)
B7LPH4 2.97e-144 406 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
C0Q2E4 4.41e-144 406 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella paratyphi C (strain RKS4594)
Q57N92 4.41e-144 406 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella choleraesuis (strain SC-B67)
A6TB39 8.24e-144 405 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7NBM1 8.71e-144 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q7CQC4 8.8e-144 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFX8 8.8e-144 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella typhi
B5BH50 8.8e-144 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella paratyphi A (strain AKU_12601)
Q5PMY8 8.8e-144 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5FSM6 8.8e-144 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella dublin (strain CT_02021853)
B5F3I5 8.8e-144 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella agona (strain SL483)
Q83KQ5 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella flexneri
Q0T3Q8 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella flexneri serotype 5b (strain 8401)
Q32H79 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q1RAR4 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain UTI89 / UPEC)
B1LD01 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain SMS-3-5 / SECEC)
B6I1E8 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain SE11)
B1J0L8 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FGQ6 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGW2 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AC31 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O1:K1 / APEC
A8A171 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O9:H4 (strain HS)
B7M2G1 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O8 (strain IAI1)
B7MW64 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O81 (strain ED1a)
B5YR15 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCH6 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O157:H7
B7L7S3 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain 55989 / EAEC)
B7MBS9 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZMZ5 1.28e-143 405 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
P76290 1.83e-143 404 78 1 240 1 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain K12)
B1XHD8 1.83e-143 404 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain K12 / DH10B)
C4ZQF4 1.83e-143 404 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7NS48 2.49e-143 404 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B4TYS8 3.58e-143 404 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella schwarzengrund (strain CVM19633)
B4SVF5 3.58e-143 404 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella newport (strain SL254)
B4T803 3.58e-143 404 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella heidelberg (strain SL476)
B5R8D2 3.58e-143 404 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R146 3.58e-143 404 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella enteritidis PT4 (strain P125109)
B7USP7 5.03e-143 403 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q322I9 5.99e-143 403 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella boydii serotype 4 (strain Sb227)
A8AFH1 6.47e-143 403 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B2U4X1 7.07e-143 403 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A9MUB4 8.42e-143 402 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
A9MNC8 8.7e-143 402 78 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q3Z2P6 1.25e-142 402 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shigella sonnei (strain Ss046)
B4ETP1 6.16e-142 400 79 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Proteus mirabilis (strain HI4320)
A7MEB1 4.4e-141 398 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Cronobacter sakazakii (strain ATCC BAA-894)
A4WBM7 3.26e-140 396 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Enterobacter sp. (strain 638)
A1JRM2 1.46e-139 395 75 2 245 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JLL8 7.1e-139 393 74 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TJK8 7.1e-139 393 74 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pestis (strain Pestoides F)
Q1CJH3 7.1e-139 393 74 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYY1 7.1e-139 393 74 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pestis bv. Antiqua (strain Angola)
Q7CIB7 7.1e-139 393 74 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pestis
Q1C823 7.1e-139 393 74 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FID3 7.1e-139 393 74 1 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q66AU7 7.1e-139 393 74 1 248 3 cmoA2 Carboxy-S-adenosyl-L-methionine synthase 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K316 7.1e-139 393 74 1 248 3 cmoA2 Carboxy-S-adenosyl-L-methionine synthase 2 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q7N555 4.25e-138 391 73 1 249 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GFJ7 6.58e-138 390 77 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Serratia proteamaculans (strain 568)
B2VJC2 4.35e-134 380 73 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6D483 7.16e-130 370 73 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NTJ7 2.86e-126 361 69 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Sodalis glossinidius (strain morsitans)
A3N0B6 2.34e-122 350 69 1 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6VQB0 3.51e-122 350 67 1 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P43985 1.33e-121 348 68 1 240 1 cmoA Carboxy-S-adenosyl-L-methionine synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B3GXJ0 1.83e-121 348 69 1 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
C3LLL0 2.28e-121 348 67 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio cholerae serotype O1 (strain M66-2)
Q9KSU2 2.28e-121 348 67 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F278 2.28e-121 348 67 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B8F3G3 2.81e-121 348 67 1 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Glaesserella parasuis serovar 5 (strain SH0165)
Q9CM57 3.86e-121 347 66 1 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pasteurella multocida (strain Pm70)
Q65UP7 6.39e-121 347 66 1 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q4QNL9 1.34e-120 346 68 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Haemophilus influenzae (strain 86-028NP)
B0BP33 1.5e-120 346 68 1 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A5UGD5 3.68e-120 345 67 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Haemophilus influenzae (strain PittGG)
Q6LT55 8.9e-120 344 67 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Photobacterium profundum (strain SS9)
B0USU1 1.43e-119 343 66 1 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Histophilus somni (strain 2336)
Q0I3S4 3.08e-119 343 66 1 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Histophilus somni (strain 129Pt)
A5UAG5 6.14e-119 342 67 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Haemophilus influenzae (strain PittEE)
Q7VLX6 1.05e-117 339 66 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q5E6A3 7.58e-116 334 64 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7MJ72 1.09e-115 334 64 1 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio vulnificus (strain YJ016)
B6EGJ0 2.88e-115 333 64 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aliivibrio salmonicida (strain LFI1238)
Q8DAN9 4.2e-115 332 64 1 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio vulnificus (strain CMCP6)
A7N1I9 4.34e-115 332 63 1 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio campbellii (strain ATCC BAA-1116)
Q87QV4 6.51e-115 332 63 1 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B5FCP8 1.2e-114 331 63 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aliivibrio fischeri (strain MJ11)
A0KIF6 1.66e-114 331 64 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SPN7 1.76e-113 328 63 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aeromonas salmonicida (strain A449)
B7VMH8 3.74e-112 325 62 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Vibrio atlanticus (strain LGP32)
C4K5W2 6.16e-109 317 66 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A8FUW4 2.68e-106 310 60 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella sediminis (strain HAW-EB3)
A4Y6S3 8.54e-104 303 60 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B1KHG9 1.59e-103 303 60 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella woodyi (strain ATCC 51908 / MS32)
A1RJQ8 5.02e-103 301 60 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella sp. (strain W3-18-1)
A9L3I3 5.85e-103 301 59 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella baltica (strain OS195)
A6WNQ8 5.85e-103 301 59 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella baltica (strain OS185)
A3D475 5.85e-103 301 59 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8CNX5 1.17e-102 301 59 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
B8EA69 1.71e-102 300 59 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella baltica (strain OS223)
A8H551 5.63e-102 299 58 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A3QEP9 1.36e-101 298 58 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q483C9 1.63e-101 298 56 1 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q8EEE7 5.01e-101 296 60 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HIZ7 8.02e-101 296 60 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella sp. (strain MR-4)
A0KWL3 8.02e-101 296 60 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella sp. (strain ANA-3)
Q0HUY5 8.14e-100 293 60 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella sp. (strain MR-7)
B0TSA1 2.51e-99 292 56 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella halifaxensis (strain HAW-EB4)
A1S6P4 7.74e-99 291 58 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q081N3 9.92e-97 286 57 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella frigidimarina (strain NCIMB 400)
Q12N04 4.15e-96 284 56 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1SST5 1.16e-94 280 56 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q5R0Q6 5.27e-93 276 49 0 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
C6E228 8.28e-92 273 55 2 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Geobacter sp. (strain M21)
Q31JJ7 1.69e-91 273 53 2 245 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3IIQ4 2.9e-91 272 53 3 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudoalteromonas translucida (strain TAC 125)
B3E6X7 4.26e-91 271 54 2 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B3PFU2 3.08e-90 269 52 1 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Cellvibrio japonicus (strain Ueda107)
B5EIQ7 8.31e-90 268 54 2 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B4S0J8 1.67e-88 265 52 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q1I5M8 1.71e-88 265 53 3 252 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas entomophila (strain L48)
Q88MX7 1.77e-88 265 53 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W8E4 3.05e-88 264 53 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q4K6X7 4.28e-88 264 54 4 253 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3K7D5 5.33e-88 264 53 4 253 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas fluorescens (strain Pf0-1)
A4VIY2 5.69e-88 264 52 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Stutzerimonas stutzeri (strain A1501)
B0KV19 2.18e-87 262 52 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas putida (strain GB-1)
B1J4E5 3.12e-87 262 52 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas putida (strain W619)
Q15NL2 7.47e-87 261 49 2 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
C3K6Z4 1.03e-86 260 53 4 253 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas fluorescens (strain SBW25)
C1DQT0 1.13e-86 260 52 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q21JL6 1.75e-86 260 51 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q39SM1 4.78e-86 259 52 2 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q87XG6 6.56e-84 253 50 3 252 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9I5G3 8.34e-84 253 51 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02HS7 8.34e-84 253 51 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q4ZPE6 4.15e-83 251 49 3 252 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas syringae pv. syringae (strain B728a)
Q48EV8 9.1e-83 250 50 3 252 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A6VAK1 9.18e-82 248 50 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas aeruginosa (strain PA7)
A4XSD1 3.02e-81 246 51 2 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Pseudomonas mendocina (strain ymp)
Q2SJW0 2.15e-80 244 47 1 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Hahella chejuensis (strain KCTC 2396)
Q0VQX7 5.09e-74 228 47 1 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q1QUG4 5.09e-74 229 45 1 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1U4B8 1.45e-73 227 47 2 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A1AXI6 4.27e-64 202 44 2 229 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Ruthia magnifica subsp. Calyptogena magnifica
A5WC54 4.22e-63 201 43 3 253 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Psychrobacter sp. (strain PRwf-1)
Q4FQB1 9.1e-63 200 42 4 259 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1Q8I4 9.92e-63 200 42 3 259 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q3A8E8 3.08e-62 198 38 0 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A5EVQ4 8.46e-56 181 42 3 227 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Dichelobacter nodosus (strain VCS1703A)
C0QJG8 8e-55 179 38 1 242 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q6AIL1 1.24e-51 171 37 2 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A8EVV4 1.09e-50 168 35 3 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Aliarcobacter butzleri (strain RM4018)
Q605H3 4.06e-47 159 34 2 243 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A0RPY4 9.21e-47 158 34 3 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter fetus subsp. fetus (strain 82-40)
Q30T90 1.38e-46 158 35 3 239 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q7MSC3 2.07e-45 155 36 4 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B9L9I3 1.23e-43 150 33 5 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q3J7D1 1.05e-42 149 34 2 241 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A6Q429 1.07e-42 148 34 3 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Nitratiruptor sp. (strain SB155-2)
A6Q7G6 2.8e-40 141 32 3 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Sulfurovum sp. (strain NBC37-1)
A7GXS7 1.03e-39 140 34 3 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter curvus (strain 525.92)
B9KG20 4.03e-39 139 30 3 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A1VYV0 6.7e-39 138 33 3 230 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A7ZED5 2.06e-38 137 35 3 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter concisus (strain 13826)
A7I232 2.36e-38 136 32 3 240 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q17YM3 2.79e-38 136 34 5 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter acinonychis (strain Sheeba)
Q5HVI0 2.88e-38 136 32 3 230 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter jejuni (strain RM1221)
Q0PAS7 2.88e-38 136 32 3 230 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7H3U1 4.52e-38 136 32 3 230 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FL14 4.92e-38 135 33 3 230 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q7VF27 5.13e-38 136 33 4 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
B2UUH2 2.13e-37 134 33 5 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain Shi470)
Q1CSK1 5.83e-37 133 34 5 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain HPAG1)
O25150 1.08e-36 132 33 6 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZKE5 1.88e-36 132 33 5 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain J99 / ATCC 700824)
Q119M3 2.16e-36 132 32 2 232 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Trichodesmium erythraeum (strain IMS101)
B6JMQ6 2.26e-36 132 33 5 248 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain P12)
B5Z863 5.99e-36 130 33 5 244 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Helicobacter pylori (strain G27)
Q5HMV4 5.48e-33 122 32 4 227 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q66B88 1.18e-22 95 28 5 241 3 cmoA1 Carboxy-S-adenosyl-L-methionine synthase 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K217 1.18e-22 95 28 5 241 3 cmoA1 Carboxy-S-adenosyl-L-methionine synthase 1 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
P20187 2.73e-05 48 28 4 156 3 None Uncharacterized 37.1 kDa protein in transposon TN4556 Streptomyces fradiae
B2IAI0 2.76e-05 48 28 4 107 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Xylella fastidiosa (strain M23)
A1TP97 5.96e-05 46 28 5 121 3 tam Trans-aconitate 2-methyltransferase Paracidovorax citrulli (strain AAC00-1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS04395
Feature type CDS
Gene cmoA
Product carboxy-S-adenosyl-L-methionine synthase CmoA
Location 930810 - 931565 (strand: -1)
Length 756 (nucleotides) / 251 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_702
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13649 Methyltransferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4106 Energy production and conversion (C) C Trans-aconitate methyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15256 tRNA (cmo5U34)-methyltransferase [EC:2.1.1.-] - -

Protein Sequence

MSKEIPDLPQDILFAAPIAQLGDWTFDEKVADVFPDMIKRSIPGYSNIIAMIGMLADRFVTPGSQVYDLGCSRAAATLSIRRNITDKTGCRIIAVDNSAPMVEHARRHIDGYKSPVPVEVIEGDIRDIAIENASMVVLNFTLQFLAPADRETLLHKIYQGLLPGGVLVLSEKFSFEDTQIGGLLFSMHHDFKRANGYSELEISQKRTMLEDVMLTDSVETHKARLKQAGFEHCEVWFQCFNFGSLLAVKEK

Flanking regions ( +/- flanking 50bp)

GGGCGGCTCTGTTAGAATACGCGCATCTTTTTGTACTGCAGACCCGTATTATGTCCAAAGAAATTCCGGATTTGCCGCAGGATATATTATTTGCGGCCCCCATTGCCCAGCTTGGTGACTGGACGTTTGATGAAAAAGTTGCGGATGTATTTCCCGACATGATCAAACGCTCAATTCCCGGGTATTCCAATATTATTGCGATGATCGGTATGCTTGCTGATCGTTTTGTCACGCCCGGCTCTCAGGTGTACGATCTCGGTTGCTCACGGGCTGCCGCGACGCTCTCCATCCGCCGTAACATCACAGATAAAACCGGCTGTCGTATCATCGCCGTGGATAACTCCGCGCCGATGGTTGAACATGCCCGCCGCCATATCGACGGCTATAAATCCCCTGTCCCGGTTGAGGTGATTGAGGGGGATATCCGTGATATTGCCATTGAAAATGCCTCAATGGTGGTACTCAATTTTACCCTGCAATTTCTCGCCCCGGCTGATCGCGAAACACTGTTGCATAAAATTTATCAGGGATTATTGCCCGGCGGTGTGCTCGTGCTGTCAGAGAAATTCAGCTTTGAAGATACACAGATTGGCGGATTGCTGTTCAGCATGCACCATGATTTTAAACGGGCAAACGGCTACAGTGAGCTGGAAATCAGCCAGAAACGCACCATGCTGGAAGATGTCATGCTGACCGACAGCGTGGAAACCCACAAAGCACGGCTGAAACAGGCAGGATTTGAACATTGTGAAGTCTGGTTCCAGTGCTTTAATTTCGGGTCGCTGCTGGCAGTAAAAGAGAAATAACATGATTGATTTCAGTGATTTTTATCAGTTAATTGCAAAAAATGAACGTC