Homologs in group_585

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01695 FBDBKF_01695 100.0 Morganella morganii S1 msrC GAF domain-containing protein, putative methionine-R-sulfoxide reductase
EHELCC_02165 EHELCC_02165 100.0 Morganella morganii S2 msrC GAF domain-containing protein, putative methionine-R-sulfoxide reductase
NLDBIP_01295 NLDBIP_01295 100.0 Morganella morganii S4 msrC GAF domain-containing protein, putative methionine-R-sulfoxide reductase
LHKJJB_00740 LHKJJB_00740 100.0 Morganella morganii S3 msrC GAF domain-containing protein, putative methionine-R-sulfoxide reductase
F4V73_RS04025 F4V73_RS04025 90.9 Morganella psychrotolerans - GAF domain-containing protein
PMI_RS04925 PMI_RS04925 64.2 Proteus mirabilis HI4320 - GAF domain-containing protein

Distribution of the homologs in the orthogroup group_585

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_585

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76270 1.11e-69 211 64 0 164 1 msrC Free methionine-R-sulfoxide reductase Escherichia coli (strain K12)
O34553 3.75e-54 171 57 1 148 3 ytsP Protein YtsP Bacillus subtilis (strain 168)
O66116 3.83e-42 140 45 1 147 3 ZMO0507 Protein ZMO0507 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q8MTJ7 2.88e-38 131 52 3 134 3 gafA GAF domain-containing protein A Dictyostelium discoideum
P36088 2.19e-31 114 41 3 151 1 YKL069W Free methionine-R-sulfoxide reductase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_00780
Feature type CDS
Gene msrC
Product GAF domain-containing protein, putative methionine-R-sulfoxide reductase
Location 133994 - 134491 (strand: 1)
Length 498 (nucleotides) / 165 (amino acids)

Contig

Accession ZDB_679
Length 398279 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_585
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13185 GAF domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1956 Defense mechanisms (V)
Signal transduction mechanisms (T)
VT GAF domain-containing protein, putative methionine-R-sulfoxide reductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08968 L-methionine (R)-S-oxide reductase [EC:1.8.4.14] Cysteine and methionine metabolism
Metabolic pathways
-

Protein Sequence

MNKLAFYQDLTRRLTSLISDEKDVIATLSNVSAVLFDELEQINWAGFYLLQGDTLVLGPFQGKVACVRIPVGRGVCGTAVAQGQVIRVDDVHDFAGHIACDSASNSEIVLPLVVNGQIIGVLDIDSPVFNRFDNNDEIGLKALNDALCAHLATCFMPKYREMIAS

Flanking regions ( +/- flanking 50bp)

ATTAAACATTACTTTAACCGGATAATTAACCCGTAACTGTAGTGTGACACATGAATAAACTCGCGTTTTATCAGGATTTAACCCGCCGTTTAACATCGCTTATCAGTGATGAGAAAGATGTCATCGCGACACTGTCCAATGTCAGTGCCGTCCTTTTTGATGAGCTGGAACAGATAAACTGGGCCGGATTCTATCTCCTTCAGGGGGATACCCTCGTGCTGGGGCCGTTCCAGGGGAAAGTAGCCTGTGTCCGCATTCCGGTTGGTCGTGGTGTCTGCGGAACCGCGGTTGCTCAGGGGCAGGTTATCCGTGTGGATGATGTGCATGATTTCGCCGGACATATTGCCTGTGATTCGGCCAGTAACTCAGAAATAGTGTTGCCGCTCGTGGTAAATGGTCAGATTATCGGCGTACTGGATATCGACAGCCCGGTTTTTAATCGTTTTGATAATAATGATGAAATTGGTCTCAAAGCCTTGAATGACGCGCTCTGCGCACATCTGGCAACGTGCTTTATGCCGAAATATCGTGAAATGATCGCAAGTTAGGCCTCCGGGAGCATAGCATTTGTCTGTAACACTATTATAATGACGCCTGT