Homologs in group_2387

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_18740 EHELCC_18740 100.0 Morganella morganii S2 ispF 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
NLDBIP_18565 NLDBIP_18565 100.0 Morganella morganii S4 ispF 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
LHKJJB_18610 LHKJJB_18610 100.0 Morganella morganii S3 ispF 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
HKOGLL_18345 HKOGLL_18345 100.0 Morganella morganii S5 ispF 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
F4V73_RS13905 F4V73_RS13905 94.3 Morganella psychrotolerans ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
PMI_RS11040 PMI_RS11040 84.3 Proteus mirabilis HI4320 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

Distribution of the homologs in the orthogroup group_2387

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2387

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q6D1B4 8.9e-102 291 89 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8G9Z3 1.43e-101 291 89 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Serratia proteamaculans (strain 568)
C6DDG1 1.61e-100 288 89 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A1JJT5 1.66e-99 286 87 1 160 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A7MJ58 8.47e-99 284 87 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cronobacter sakazakii (strain ATCC BAA-894)
B1JJF7 1.85e-98 283 86 1 160 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EC2 1.85e-98 283 86 1 160 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPZ8 1.85e-98 283 86 1 160 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pestis (strain Pestoides F)
Q1CLR5 1.85e-98 283 86 1 160 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R118 1.85e-98 283 86 1 160 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBP7 1.85e-98 283 86 1 160 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pestis
Q1C477 1.85e-98 283 86 1 160 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLX7 1.85e-98 283 86 1 160 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2VFZ6 2.43e-97 280 85 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B2K578 4.04e-97 280 86 1 160 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q2NVM3 2.99e-96 277 84 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Sodalis glossinidius (strain morsitans)
Q7N8K6 1.27e-95 276 91 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C5BGJ0 7.94e-95 274 85 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Edwardsiella ictaluri (strain 93-146)
Q3YYB6 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shigella sonnei (strain Ss046)
P62619 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shigella flexneri
Q0T1H7 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shigella flexneri serotype 5b (strain 8401)
Q32CI4 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q31XA8 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shigella boydii serotype 4 (strain Sb227)
B2TZI5 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LWK9 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I6D6 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli (strain SE11)
B7N6X6 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P62617 1.29e-92 268 89 0 157 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli (strain K12)
B1IUT3 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A3M5 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O9:H4 (strain HS)
B1XCS2 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli (strain K12 / DH10B)
C4ZZQ0 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LXF8 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O8 (strain IAI1)
B7NT90 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z3A8 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P62618 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O157:H7
B7LEG4 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli (strain 55989 / EAEC)
A7ZQJ0 1.29e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
B1LQ66 1.78e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli (strain SMS-3-5 / SECEC)
Q8FEJ6 1.78e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MZ47 1.78e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O81 (strain ED1a)
B5XV35 1.88e-92 268 89 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Klebsiella pneumoniae (strain 342)
Q8Z472 2.44e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella typhi
B4TTW0 2.44e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella schwarzengrund (strain CVM19633)
B5BEY3 2.44e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella paratyphi A (strain AKU_12601)
C0PXA6 2.44e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella paratyphi C (strain RKS4594)
A9N2D2 2.44e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PEG2 2.44e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T456 2.44e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella newport (strain SL254)
B4TFW6 2.44e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella heidelberg (strain SL476)
B5F410 2.44e-92 268 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella agona (strain SL483)
A8ANW0 5.2e-92 267 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6TD38 7.81e-92 266 89 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q8ZMF7 9.83e-92 266 89 0 157 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57KJ5 1.4e-91 266 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella choleraesuis (strain SC-B67)
B7UHG5 1.51e-91 266 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q1R7U5 1.65e-91 265 88 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli (strain UTI89 / UPEC)
A1AEU0 1.65e-91 265 88 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O1:K1 / APEC
B7MKM0 1.65e-91 265 88 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0TEB2 2.03e-91 265 88 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A9MF29 2.07e-91 265 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5RDQ2 2.31e-91 265 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QW17 2.31e-91 265 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella enteritidis PT4 (strain P125109)
B5FTS4 2.31e-91 265 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella dublin (strain CT_02021853)
B4F226 4.14e-91 265 85 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Proteus mirabilis (strain HI4320)
A4WDV1 6e-91 264 89 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Enterobacter sp. (strain 638)
P44815 1.96e-86 253 75 0 157 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UE60 1.96e-86 253 75 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Haemophilus influenzae (strain PittEE)
A5UHG0 4.32e-86 252 74 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Haemophilus influenzae (strain PittGG)
Q4QMP5 8.25e-85 248 73 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Haemophilus influenzae (strain 86-028NP)
Q65Q79 1.4e-84 248 74 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B5FAF6 6.33e-83 244 73 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Aliivibrio fischeri (strain MJ11)
Q5E329 3.1e-82 242 72 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A6VQY0 5.31e-82 241 73 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B6EKL5 5.87e-82 241 73 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Aliivibrio salmonicida (strain LFI1238)
A7MTS5 3.74e-81 239 73 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Vibrio campbellii (strain ATCC BAA-1116)
Q47956 4.22e-81 239 73 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q87LQ3 1.29e-80 238 72 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B3H1E2 2.6e-80 237 71 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q7MHQ5 2.84e-80 237 71 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Vibrio vulnificus (strain YJ016)
B0BP83 5.66e-80 236 71 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N0G3 5.66e-80 236 71 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q8DC59 1.17e-79 235 70 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Vibrio vulnificus (strain CMCP6)
P57954 1.95e-79 235 77 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pasteurella multocida (strain Pm70)
B8F4V8 3.18e-79 234 71 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Glaesserella parasuis serovar 5 (strain SH0165)
Q6LMT4 8.86e-79 233 71 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Photobacterium profundum (strain SS9)
A1S4E0 2.2e-77 230 70 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q0I5H9 5.12e-77 229 76 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Histophilus somni (strain 129Pt)
A8H1S8 1.23e-76 228 69 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0URU8 1.27e-76 228 75 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Histophilus somni (strain 2336)
B0TK07 2.3e-76 227 70 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella halifaxensis (strain HAW-EB4)
A3QC80 2.43e-76 227 70 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A9KYG7 3.15e-75 224 70 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella baltica (strain OS195)
A6WR25 3.15e-75 224 70 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella baltica (strain OS185)
A3D792 3.15e-75 224 70 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A1RHF6 5.88e-75 224 68 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella sp. (strain W3-18-1)
A4Y940 5.88e-75 224 68 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q0HXG7 1.59e-74 223 71 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella sp. (strain MR-7)
Q0HL69 1.59e-74 223 71 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella sp. (strain MR-4)
A0KU85 1.59e-74 223 71 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella sp. (strain ANA-3)
Q15P30 1.96e-74 223 67 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q8EBR3 2.44e-74 222 71 0 156 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q2SKW6 2.76e-74 222 69 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Hahella chejuensis (strain KCTC 2396)
B8E8T4 3.25e-74 222 69 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella baltica (strain OS223)
B8CJP9 3.51e-74 222 67 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
A4VJV0 1.24e-73 220 69 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Stutzerimonas stutzeri (strain A1501)
B1KPT3 3.7e-73 219 67 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella woodyi (strain ATCC 51908 / MS32)
Q12PZ1 4.55e-73 219 67 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q48F85 1.17e-72 218 68 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A4XWR4 1.18e-72 218 69 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas mendocina (strain ymp)
B1JB32 2.06e-72 217 68 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas putida (strain W619)
C3LS19 2.33e-72 217 73 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Vibrio cholerae serotype O1 (strain M66-2)
Q9KUJ1 2.33e-72 217 73 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F9D7 2.33e-72 217 73 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q086A7 4.3e-72 216 67 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella frigidimarina (strain NCIMB 400)
C1DSS0 9.67e-72 215 67 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q3IDQ5 1.29e-71 215 66 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudoalteromonas translucida (strain TAC 125)
C3K703 1.62e-71 215 67 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas fluorescens (strain SBW25)
Q886L7 1.83e-71 215 68 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q02R99 3.45e-71 214 67 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
A8FST1 3.6e-71 214 71 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella sediminis (strain HAW-EB3)
B8GQ78 4.34e-71 214 67 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q88MF3 5.58e-71 213 67 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W823 5.58e-71 213 67 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0KSC5 7.84e-71 213 67 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas putida (strain GB-1)
A6V1G1 1.05e-70 213 67 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas aeruginosa (strain PA7)
Q4ZWQ2 1.26e-70 213 68 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas syringae pv. syringae (strain B728a)
Q1I652 1.34e-70 213 67 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas entomophila (strain L48)
P57708 1.86e-70 212 67 0 155 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V8C1 1.86e-70 212 67 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas aeruginosa (strain LESB58)
Q3KH86 6.08e-70 211 66 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas fluorescens (strain Pf0-1)
Q4KHF0 7.65e-70 211 68 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q21LB9 8.17e-70 211 68 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q487E8 6.32e-69 209 61 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A7GJZ8 2e-68 207 64 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q73FC0 2.45e-67 204 63 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
A9VN99 3.93e-67 204 63 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus mycoides (strain KBAB4)
Q6HPT1 3.93e-67 204 63 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63HB3 3.93e-67 204 63 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain ZK / E33L)
Q81J62 3.93e-67 204 63 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IZH1 3.93e-67 204 63 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain Q1)
B7HQS1 3.93e-67 204 63 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain AH187)
C1ET16 3.93e-67 204 63 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain 03BB102)
B7ISZ6 3.93e-67 204 63 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain G9842)
B7JK94 3.93e-67 204 63 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain AH820)
Q81VV4 3.93e-67 204 63 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus anthracis
A0R8F8 3.93e-67 204 63 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus thuringiensis (strain Al Hakam)
C3LJ59 3.93e-67 204 63 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9N2 3.93e-67 204 63 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus anthracis (strain A0248)
B7HJ25 1.14e-66 202 63 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain B4264)
Q5QUC4 2.17e-66 202 61 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q1QU74 3.06e-65 199 64 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
C5D3P3 4.65e-65 199 61 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Geobacillus sp. (strain WCH70)
B3PJB0 8.86e-65 198 62 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cellvibrio japonicus (strain Ueda107)
Q39ZL6 6.36e-64 196 63 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q8K9D7 2.74e-63 194 51 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B2UFT6 4.2e-63 194 59 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Ralstonia pickettii (strain 12J)
A7Z0L3 4.56e-63 193 60 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q604M1 6.2e-63 193 62 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1K645 9.48e-63 193 60 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Azoarcus sp. (strain BH72)
Q9KGF7 1.22e-62 192 61 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q65PD1 1.29e-62 192 61 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q747A0 1.33e-62 192 62 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B2JGK3 1.54e-62 192 61 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A9AIT6 1.64e-62 192 60 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia multivorans (strain ATCC 17616 / 249)
Q39FB9 1.79e-62 192 62 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0VQD3 3.77e-62 191 62 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
C1KYG9 4.3e-62 191 57 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Listeria monocytogenes serotype 4b (strain CLIP80459)
B1YS10 4.74e-62 191 61 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia ambifaria (strain MC40-6)
Q3SK37 5.71e-62 191 59 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Thiobacillus denitrificans (strain ATCC 25259)
Q63T71 8.83e-62 190 59 0 159 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia pseudomallei (strain K96243)
A3NAL8 8.83e-62 190 59 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia pseudomallei (strain 668)
Q3JRA0 8.83e-62 190 59 0 159 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia pseudomallei (strain 1710b)
A3NWD9 8.83e-62 190 59 0 159 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia pseudomallei (strain 1106a)
A1V4Z9 8.83e-62 190 59 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia mallei (strain SAVP1)
Q62JI6 8.83e-62 190 59 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia mallei (strain ATCC 23344)
A2SBD7 8.83e-62 190 59 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia mallei (strain NCTC 10229)
A3MKM3 8.83e-62 190 59 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia mallei (strain NCTC 10247)
Q8XYW2 1.12e-61 190 59 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q0SQN0 1.39e-61 190 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium perfringens (strain SM101 / Type A)
Q2SWT5 1.48e-61 190 59 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q724H6 1.75e-61 189 57 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Listeria monocytogenes serotype 4b (strain F2365)
Q8XI08 1.95e-61 189 59 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium perfringens (strain 13 / Type A)
Q0TMY4 1.95e-61 189 59 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0BED7 2.14e-61 189 60 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q493M8 2.95e-61 189 56 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Blochmanniella pennsylvanica (strain BPEN)
B8DF19 3.48e-61 189 57 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Listeria monocytogenes serotype 4a (strain HCC23)
Q0KBM9 3.72e-61 189 59 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B8D7U9 5.26e-61 188 51 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57494 5.26e-61 188 51 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9J7 5.26e-61 188 51 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q06756 6.28e-61 188 59 0 157 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus subtilis (strain 168)
Q8YAB4 7.16e-61 188 57 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
A5G939 8.44e-61 187 62 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Geotalea uraniireducens (strain Rf4)
B3R4U4 8.55e-61 188 58 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A4JF19 8.81e-61 187 60 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BHA4 8.89e-61 188 60 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia orbicola (strain AU 1054)
B1JTX0 8.89e-61 188 60 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia orbicola (strain MC0-3)
B4EC22 8.89e-61 188 60 0 156 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K866 8.89e-61 188 60 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia cenocepacia (strain HI2424)
Q5NYK0 9.89e-61 188 59 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q1LLZ4 1.3e-60 187 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q0A7K7 1.5e-60 187 56 1 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B2T3X3 3.57e-60 186 57 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q18CD3 6.65e-60 186 56 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridioides difficile (strain 630)
B1HNM6 7.44e-60 185 58 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Lysinibacillus sphaericus (strain C3-41)
B0TYX5 7.52e-60 185 58 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q13Z30 7.85e-60 185 57 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Paraburkholderia xenovorans (strain LB400)
Q3A8C7 8.35e-60 186 61 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A4IJG5 1.14e-59 185 58 0 160 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Geobacillus thermodenitrificans (strain NG80-2)
Q2KUX6 3.83e-59 184 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bordetella avium (strain 197N)
Q92F39 4.68e-59 183 57 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B3E280 6.28e-59 183 60 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A8F959 1.02e-58 182 58 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus pumilus (strain SAFR-032)
A1AJY3 1.09e-58 182 60 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q5F830 1.29e-58 182 55 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q1H2A2 2.25e-58 182 57 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q472F1 2.36e-58 182 56 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q82US7 3.44e-58 181 59 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q9JTM4 3.49e-58 181 55 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A1KUU9 3.77e-58 181 55 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JYM5 3.77e-58 181 55 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M0U6 3.77e-58 181 55 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Neisseria meningitidis serogroup C (strain 053442)
Q3JCS8 5.85e-58 181 55 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A0Q6Y1 7.6e-58 180 57 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella tularensis subsp. novicida (strain U112)
A8MLB2 9.06e-58 180 61 0 145 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Alkaliphilus oremlandii (strain OhILAs)
Q5L432 1.3e-57 180 58 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Geobacillus kaustophilus (strain HTA426)
B9LZW2 2.1e-57 179 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q5WLT6 3.51e-57 179 55 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shouchella clausii (strain KSM-K16)
B2RGP8 5.98e-57 178 56 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q2Y752 7.16e-57 178 59 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
C1D559 7.86e-57 178 57 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Laribacter hongkongensis (strain HLHK9)
Q3A9N8 7.94e-57 178 57 0 152 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A4IYG6 1.52e-56 177 56 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella tularensis subsp. tularensis (strain WY96-3418)
B2SDD4 1.52e-56 177 56 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A3Z7 1.52e-56 177 56 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella tularensis subsp. holarctica (strain LVS)
A7NBK5 1.52e-56 177 56 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A9II47 1.91e-56 177 55 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q7MXX0 2.13e-56 177 56 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q0BMD2 3.49e-56 176 56 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella tularensis subsp. holarctica (strain OSU18)
Q0AGI1 3.86e-56 176 57 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1TZ51 4.02e-56 176 62 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q839V8 4.7e-56 176 52 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Enterococcus faecalis (strain ATCC 700802 / V583)
Q5NFU1 7.26e-56 175 56 1 157 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14H93 7.26e-56 175 56 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella tularensis subsp. tularensis (strain FSC 198)
A5N3R3 8.98e-56 175 53 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DXE4 8.98e-56 175 53 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium kluyveri (strain NBRC 12016)
B0V6G3 1.12e-55 175 55 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acinetobacter baumannii (strain AYE)
A3M665 1.12e-55 175 55 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2I336 1.12e-55 175 55 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acinetobacter baumannii (strain ACICU)
B7I9W0 1.12e-55 175 55 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acinetobacter baumannii (strain AB0057)
B7H1F3 1.12e-55 175 55 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acinetobacter baumannii (strain AB307-0294)
A4J0Y4 1.67e-55 174 55 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B0VMT6 1.78e-55 174 55 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acinetobacter baumannii (strain SDF)
B0S2Q7 4.66e-55 173 53 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
C4Z3N3 9.89e-55 173 57 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
Q899E9 1.53e-54 172 54 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium tetani (strain Massachusetts / E88)
A6TWK9 2.32e-54 171 56 0 151 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Alkaliphilus metalliredigens (strain QYMF)
Q6FAU4 5.07e-54 171 54 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
C4Z8W9 5.08e-54 171 54 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
A0LIS1 7.81e-54 170 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q0AUF5 1.54e-53 169 52 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q97LX0 1.9e-53 169 51 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B2UYW8 5.48e-53 168 51 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain Alaska E43 / Type E3)
A4WSL4 6.1e-53 168 53 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q165P5 9.23e-53 167 50 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
C1FQ26 1.04e-52 167 53 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain Kyoto / Type A2)
B1ID41 1.11e-52 167 53 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain Okra / Type B1)
C3KXW6 1.17e-52 167 53 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain 657 / Type Ba4)
B1KRX5 1.32e-52 167 53 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain Loch Maree / Type A3)
A7G9H1 1.32e-52 167 53 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5HXW3 1.32e-52 167 53 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FQ95 1.32e-52 167 53 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain ATCC 19397 / Type A)
B3QV82 1.84e-52 167 53 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B3QPS3 1.88e-52 167 52 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B9KSH9 2.24e-52 166 54 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3J2K8 2.24e-52 166 54 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PJQ4 2.24e-52 166 54 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B3EMU1 4.04e-52 166 52 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chlorobium phaeobacteroides (strain BS1)
A0Q3K0 4.18e-52 166 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium novyi (strain NT)
A6LF29 4.25e-52 166 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q8YQF0 6.19e-52 166 51 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3MC53 9.27e-52 165 51 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q7NYL5 2.3e-51 164 56 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7VZN1 3.49e-51 164 57 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W5D0 3.49e-51 164 57 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
A4XJU4 9.41e-51 162 47 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q8PLR7 1.19e-50 162 50 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xanthomonas axonopodis pv. citri (strain 306)
B8HVI5 1.74e-50 162 50 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
A6LQ55 1.89e-50 161 54 0 145 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q21YT7 2.1e-50 169 54 0 156 3 ispDF Bifunctional enzyme IspD/IspF Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q8P9Z0 2.46e-50 161 50 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU02 2.46e-50 161 50 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xanthomonas campestris pv. campestris (strain B100)
Q4UTP5 2.46e-50 161 50 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xanthomonas campestris pv. campestris (strain 8004)
Q0C0N0 2.7e-50 168 55 0 154 3 ispDF Bifunctional enzyme IspD/IspF Hyphomonas neptunium (strain ATCC 15444)
B2JA49 3.08e-50 161 48 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q5GYK7 3.69e-50 161 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SUA9 3.69e-50 161 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P1L1 3.69e-50 161 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8KC25 3.73e-50 160 52 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q3BUS7 4.98e-50 160 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q7WCW4 7.44e-50 160 56 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8DHC4 1.43e-49 159 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B2A4B2 1.49e-49 159 50 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q1QBM3 1.94e-49 159 58 1 160 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
C0R0Y4 2.28e-49 159 46 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
A6L0V6 2.43e-49 159 50 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A1WWY9 2.94e-49 159 53 1 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Halorhodospira halophila (strain DSM 244 / SL1)
P73426 3.01e-49 159 51 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B4S5L1 3.54e-49 158 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q5N549 5.21e-49 158 50 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31P19 5.21e-49 158 50 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8D224 5.3e-49 158 45 2 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Wigglesworthia glossinidia brevipalpis
B8FHQ6 6.91e-49 157 52 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Desulfatibacillum aliphaticivorans
Q6ARN9 8.37e-49 164 50 0 154 3 ispDF Bifunctional enzyme IspD/IspF Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q8A0Y7 9.21e-49 157 50 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B2TIU0 9.45e-49 157 49 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain Eklund 17B / Type B)
Q250Q9 1.02e-48 157 54 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Desulfitobacterium hafniense (strain Y51)
B8G1T9 1.02e-48 157 54 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B6YRV8 1.52e-48 157 47 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Azobacteroides pseudotrichonymphae genomovar. CFP2
Q4FSB5 1.67e-48 157 58 1 160 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1GGW9 1.67e-48 163 49 0 157 3 ispDF Bifunctional enzyme IspD/IspF Ruegeria sp. (strain TM1040)
A4SFZ0 1.69e-48 157 50 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q87DY3 1.73e-48 157 48 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
A7ZCQ2 2.33e-48 162 57 0 152 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter concisus (strain 13826)
Q9PDT5 2.96e-48 157 48 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xylella fastidiosa (strain 9a5c)
A6Q7M3 3.02e-48 162 51 0 152 3 ispDF Bifunctional enzyme IspD/IspF Sulfurovum sp. (strain NBC37-1)
Q67JP6 4.5e-48 155 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B9KEX3 5.2e-48 162 55 0 145 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q5L8X2 6.02e-48 155 50 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q64P34 7.66e-48 155 50 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacteroides fragilis (strain YCH46)
Q2GIK8 9.05e-48 155 48 2 160 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Anaplasma phagocytophilum (strain HZ)
A7H5V8 1.57e-47 160 53 0 145 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A1B890 1.7e-47 160 50 0 156 3 ispDF Bifunctional enzyme IspD/IspF Paracoccus denitrificans (strain Pd 1222)
A1W1K9 2.07e-47 160 53 0 145 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FNR8 2.07e-47 160 53 0 145 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q5HSI4 2.28e-47 160 53 0 145 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter jejuni (strain RM1221)
Q9PM68 2.35e-47 160 53 0 145 1 ispDF Bifunctional enzyme IspD/IspF Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q2GHV0 2.97e-47 154 47 1 162 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
B9MRD4 6.18e-47 152 45 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q11Q93 6.23e-47 152 45 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
C1A8W3 7.15e-47 153 48 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
A7GZI1 7.23e-47 159 55 0 151 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter curvus (strain 525.92)
A8ER37 8.07e-47 159 50 0 151 3 ispDF Bifunctional enzyme IspD/IspF Aliarcobacter butzleri (strain RM4018)
Q8R7S8 9.1e-47 152 48 1 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8R6E7 1.08e-46 152 46 0 160 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q1AU09 1.35e-46 152 53 3 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
B8D0A0 1.46e-46 152 46 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q9M4W3 2.13e-46 154 48 0 156 2 ISPF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic Catharanthus roseus
Q9CAK8 2.27e-46 154 48 0 156 1 ISPF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic Arabidopsis thaliana
Q2NAE1 2.49e-46 158 50 0 158 3 ispDF Bifunctional enzyme IspD/IspF Erythrobacter litoralis (strain HTCC2594)
Q2JNA9 4e-46 150 49 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q2JXJ4 4e-46 150 49 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Synechococcus sp. (strain JA-3-3Ab)
Q3YT02 4.64e-46 151 47 1 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Ehrlichia canis (strain Jake)
Q6EPN6 5.2e-46 152 48 0 156 1 ISPF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic Oryza sativa subsp. japonica
A6Q2K0 5.89e-46 156 52 0 153 3 ispDF Bifunctional enzyme IspD/IspF Nitratiruptor sp. (strain SB155-2)
Q3APP2 6.12e-46 150 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chlorobium chlorochromatii (strain CaD3)
Q7MQW9 1.22e-45 156 55 2 152 3 ispDF Bifunctional enzyme IspD/IspF Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A0RN28 1.49e-45 155 50 0 151 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter fetus subsp. fetus (strain 82-40)
Q3B2H9 1.86e-45 149 49 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q2RFM1 2.52e-45 149 57 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q0BTD5 2.55e-45 155 50 0 154 3 ispDF Bifunctional enzyme IspD/IspF Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q5LRN5 3.62e-45 154 45 0 156 3 ispDF Bifunctional enzyme IspD/IspF Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A1WR07 4.12e-45 149 54 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Verminephrobacter eiseniae (strain EF01-2)
A1BE20 5.53e-45 147 48 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q2GER2 5.58e-45 148 47 2 165 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
A7I1V2 7.17e-45 154 52 1 151 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q2LUT1 7.49e-45 147 46 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Syntrophus aciditrophicus (strain SB)
Q08113 8.41e-45 154 47 0 157 3 ispDF Bifunctional enzyme IspD/IspF Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q0IC27 8.67e-45 147 48 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Synechococcus sp. (strain CC9311)
Q89LQ8 9.76e-45 154 50 0 154 3 ispDF Bifunctional enzyme IspD/IspF Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q47EL1 1.07e-44 147 54 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Dechloromonas aromatica (strain RCB)
B0CBC9 1.56e-44 147 46 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acaryochloris marina (strain MBIC 11017)
Q3SSN8 2.29e-44 153 51 0 154 3 ispDF Bifunctional enzyme IspD/IspF Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A5D5L5 2.61e-44 146 49 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A5EIY9 3.23e-44 152 50 0 154 3 ispDF Bifunctional enzyme IspD/IspF Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B4SE23 4.12e-44 145 48 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q1QM99 4.25e-44 152 50 0 154 3 ispDF Bifunctional enzyme IspD/IspF Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A4YUQ7 6.58e-44 152 50 0 154 3 ispDF Bifunctional enzyme IspD/IspF Bradyrhizobium sp. (strain ORS 278)
Q137C3 7.2e-44 152 50 0 154 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain BisB5)
Q07MZ2 9.1e-44 151 50 0 154 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain BisA53)
Q2G708 1.12e-43 151 52 0 155 3 ispDF Bifunctional enzyme IspD/IspF Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q6N6M5 1.28e-43 151 50 0 154 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A8IBL6 1.29e-43 151 51 0 154 3 ispDF Bifunctional enzyme IspD/IspF Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B3QIL5 1.31e-43 151 50 0 154 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain TIE-1)
Q214R1 1.33e-43 151 51 0 154 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain BisB18)
B1GYT3 1.58e-43 144 44 0 152 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Endomicrobium trichonymphae
A7HXV6 1.64e-43 150 48 0 154 3 ispDF Bifunctional enzyme IspD/IspF Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q2RTS1 1.94e-43 150 50 0 154 3 ispDF Bifunctional enzyme IspD/IspF Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q5P993 1.98e-43 144 46 1 163 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Anaplasma marginale (strain St. Maries)
Q92Q90 2.02e-43 150 50 0 158 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium meliloti (strain 1021)
Q2IW23 2.79e-43 150 50 0 154 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain HaA2)
Q8YHD8 2.9e-43 150 48 0 155 3 ispDF Bifunctional enzyme IspD/IspF Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57D18 2.9e-43 150 48 0 155 3 ispDF Bifunctional enzyme IspD/IspF Brucella abortus biovar 1 (strain 9-941)
Q2YPW1 2.9e-43 150 48 0 155 3 ispDF Bifunctional enzyme IspD/IspF Brucella abortus (strain 2308)
A5VQP4 3.09e-43 150 48 0 155 3 ispDF Bifunctional enzyme IspD/IspF Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A8LKV5 3.14e-43 150 44 0 156 3 ispDF Bifunctional enzyme IspD/IspF Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q9RNZ1 3.34e-43 150 52 0 148 3 ispDF Bifunctional enzyme IspD/IspF Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B3PYS4 4.06e-43 150 49 0 155 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium etli (strain CIAT 652)
Q7VFU3 4.3e-43 149 51 0 148 3 ispDF Bifunctional enzyme IspD/IspF Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q3ZAD6 7.42e-43 142 47 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q7UU80 1.06e-42 142 46 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q2IQG8 1.16e-42 148 50 1 154 3 ispDF Bifunctional enzyme IspD/IspF Anaeromyxobacter dehalogenans (strain 2CP-C)
Q3ZWG5 1.92e-42 141 47 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Dehalococcoides mccartyi (strain CBDB1)
Q04XV1 2.77e-42 141 44 1 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04VM3 2.77e-42 141 44 1 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B8GW85 4.26e-42 147 50 0 152 3 ispDF Bifunctional enzyme IspD/IspF Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A7I5 4.26e-42 147 50 0 152 3 ispDF Bifunctional enzyme IspD/IspF Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8G0H4 5.32e-42 147 47 0 155 3 ispDF Bifunctional enzyme IspD/IspF Brucella suis biovar 1 (strain 1330)
Q30QG7 5.41e-42 146 49 0 151 3 ispDF Bifunctional enzyme IspD/IspF Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A6X0N1 5.53e-42 147 47 0 155 3 ispDF Bifunctional enzyme IspD/IspF Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B5ZNB6 6.93e-42 147 48 0 155 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q2K8V5 7.23e-42 147 48 0 155 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q98MX9 8.72e-42 146 47 0 155 3 ispDF Bifunctional enzyme IspD/IspF Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1GTN0 1.24e-41 145 50 1 157 3 ispDF Bifunctional enzyme IspD/IspF Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A1USA2 1.39e-41 145 47 0 155 3 ispDF Bifunctional enzyme IspD/IspF Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q1MH21 2.39e-41 145 47 0 155 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2S211 2.51e-41 138 50 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salinibacter ruber (strain DSM 13855 / M31)
Q6G164 2.69e-41 145 45 0 155 3 ispDF Bifunctional enzyme IspD/IspF Bartonella quintana (strain Toulouse)
A6U8F8 3.26e-41 145 48 0 158 3 ispDF Bifunctional enzyme IspD/IspF Sinorhizobium medicae (strain WSM419)
Q1IVA8 4.3e-41 137 47 0 142 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Koribacter versatilis (strain Ellin345)
A8G687 4.65e-41 138 43 1 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Prochlorococcus marinus (strain MIT 9215)
Q319L1 4.89e-41 138 43 1 160 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Prochlorococcus marinus (strain MIT 9312)
B9JF01 9.05e-41 144 47 0 155 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A9A0H0 2.03e-40 136 49 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q28Q60 2.16e-40 142 45 0 155 3 ispDF Bifunctional enzyme IspD/IspF Jannaschia sp. (strain CCS1)
Q310X3 2.86e-40 142 49 1 145 3 ispDF Bifunctional enzyme IspD/IspF Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A9IS87 3.43e-40 142 46 0 152 3 ispDF Bifunctional enzyme IspD/IspF Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q11HV9 5.96e-40 142 46 0 145 3 ispDF Bifunctional enzyme IspD/IspF Chelativorans sp. (strain BNC1)
Q73G24 6.16e-40 141 44 1 159 3 ispDF Bifunctional enzyme IspD/IspF Wolbachia pipientis wMel
Q2W4Q8 7.29e-40 141 51 1 153 3 ispDF Bifunctional enzyme IspD/IspF Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q6G3Z8 1.61e-39 140 46 0 152 3 ispDF Bifunctional enzyme IspD/IspF Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q5FQD6 1.78e-39 140 47 1 157 3 ispDF Bifunctional enzyme IspD/IspF Gluconobacter oxydans (strain 621H)
Q027G2 2.85e-39 133 46 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Solibacter usitatus (strain Ellin6076)
Q7NFH8 3.73e-39 133 47 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q5HC74 5.69e-39 133 45 1 160 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Ehrlichia ruminantium (strain Welgevonden)
Q4FM31 7.39e-39 138 41 0 159 3 ispDF Bifunctional enzyme IspD/IspF Pelagibacter ubique (strain HTCC1062)
B1I0S9 1e-38 138 48 0 139 3 ispDF Bifunctional enzyme IspD/IspF Desulforudis audaxviator (strain MP104C)
Q5GSM7 1.23e-38 138 45 1 160 3 ispDF Bifunctional enzyme IspD/IspF Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q8F0A5 3.28e-38 130 44 1 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q5FF92 3.39e-38 131 44 1 163 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Ehrlichia ruminantium (strain Gardel)
Q8UFF4 3.66e-38 137 45 0 155 3 ispDF Bifunctional enzyme IspD/IspF Agrobacterium fabrum (strain C58 / ATCC 33970)
A5V2U9 3.96e-38 136 48 0 155 3 ispDF Bifunctional enzyme IspD/IspF Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B6JL03 4.11e-38 137 46 0 148 3 ispDF Bifunctional enzyme IspD/IspF Helicobacter pylori (strain P12)
Q72UP7 4.85e-38 130 44 1 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B2USR1 5.87e-38 136 46 0 148 3 ispDF Bifunctional enzyme IspD/IspF Helicobacter pylori (strain Shi470)
O25664 6.32e-38 136 46 0 148 1 ispDF Bifunctional enzyme IspD/IspF Helicobacter pylori (strain ATCC 700392 / 26695)
Q1CU78 7.32e-38 136 46 0 148 3 ispDF Bifunctional enzyme IspD/IspF Helicobacter pylori (strain HPAG1)
Q9ZM19 7.54e-38 136 46 0 148 3 ispDF Bifunctional enzyme IspD/IspF Helicobacter pylori (strain J99 / ATCC 700824)
Q17WU1 1.07e-37 135 46 0 150 3 ispDF Bifunctional enzyme IspD/IspF Helicobacter acinonychis (strain Sheeba)
B9JW91 1.39e-37 135 45 0 155 3 ispDF Bifunctional enzyme IspD/IspF Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B0SJL7 5.83e-37 127 42 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SAT2 5.83e-37 127 42 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
B5Z6H4 6.25e-37 134 45 0 148 3 ispDF Bifunctional enzyme IspD/IspF Helicobacter pylori (strain G27)
Q47KT3 8.13e-37 127 45 1 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Thermobifida fusca (strain YX)
Q0APQ6 3.44e-35 129 46 0 148 3 ispDF Bifunctional enzyme IspD/IspF Maricaulis maris (strain MCS10)
A7HDA2 4.06e-35 129 50 1 154 3 ispDF Bifunctional enzyme IspD/IspF Anaeromyxobacter sp. (strain Fw109-5)
Q73KC6 4.24e-35 122 44 0 133 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
B2URI3 8.13e-35 122 43 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
O67089 1.41e-34 121 41 2 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Aquifex aeolicus (strain VF5)
O83525 2.27e-34 127 41 0 156 3 ispDF Bifunctional enzyme IspD/IspF Treponema pallidum (strain Nichols)
Q2J543 2.53e-34 120 42 2 161 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
C4XSW4 3.16e-34 126 45 2 159 3 ispDF Bifunctional enzyme IspD/IspF Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q0RBN8 3.35e-34 120 43 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q6ADI0 6.3e-34 125 45 1 154 3 ispDF Bifunctional enzyme IspD/IspF Leifsonia xyli subsp. xyli (strain CTCB07)
Q72HP8 1.12e-32 116 46 0 137 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A4XCN1 1.74e-32 116 41 1 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q8RQP5 7.57e-32 114 45 0 137 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q1MR76 1.63e-31 119 41 1 151 3 ispDF Bifunctional enzyme IspD/IspF Lawsonia intracellularis (strain PHE/MN1-00)
A8LF85 3.97e-31 112 41 2 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Parafrankia sp. (strain EAN1pec)
B9KAZ0 7.18e-31 112 42 2 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q9WZB5 1.13e-30 111 42 2 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A1SNY6 1.91e-30 111 41 2 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Nocardioides sp. (strain ATCC BAA-499 / JS614)
B2HJ22 4.68e-30 110 40 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium marinum (strain ATCC BAA-535 / M)
A1VDX6 9.73e-30 114 47 0 144 3 ispDF Bifunctional enzyme IspD/IspF Nitratidesulfovibrio vulgaris (strain DP4)
Q72C30 9.73e-30 114 47 0 144 3 ispDF Bifunctional enzyme IspD/IspF Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A0LQZ7 1.38e-29 108 38 1 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
P9WKG5 1.54e-29 108 41 1 155 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKG4 1.54e-29 108 41 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U8Q6 1.54e-29 108 41 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AI40 1.54e-29 108 41 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KPR7 1.54e-29 108 41 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P65184 1.54e-29 108 41 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q6AAV7 2.55e-29 108 40 2 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cutibacterium acnes (strain DSM 16379 / KPA171202)
A8M7S7 3.62e-29 107 39 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salinispora arenicola (strain CNS-205)
Q0S889 4.77e-29 107 39 1 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Rhodococcus jostii (strain RHA1)
C0ZPR8 4.77e-29 107 40 1 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
A5CTY4 6.08e-29 112 41 1 154 3 ispDF Bifunctional enzyme IspD/IspF Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q9CCW5 7.93e-29 107 40 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium leprae (strain TN)
B8ZUA8 7.93e-29 107 40 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium leprae (strain Br4923)
C1BAC3 1.67e-28 105 40 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Rhodococcus opacus (strain B4)
Q9RXS6 1.78e-28 105 42 1 140 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A6W6E9 3.19e-27 102 40 2 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
P62369 4.12e-27 104 35 3 174 1 IspF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, apicoplast Plasmodium falciparum (isolate HB3)
P62368 4.12e-27 104 35 3 174 1 IspF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, apicoplast Plasmodium falciparum (isolate 3D7)
Q5Z2R2 5.42e-27 102 40 1 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Nocardia farcinica (strain IFM 10152)
Q743W4 1.22e-25 98 40 1 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QAB4 1.22e-25 98 40 1 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium avium (strain 104)
A1TG10 2.11e-25 98 38 1 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
B8HCR6 3.93e-25 97 41 2 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_18995
Feature type CDS
Gene ispF
Product 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
Location 16451 - 16933 (strand: -1)
Length 483 (nucleotides) / 160 (amino acids)
In genomic island -

Contig

Accession contig_37
Length 25512 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2387
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02542 YgbB family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0245 Lipid transport and metabolism (I) I 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01770 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:4.6.1.12] Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
C5 isoprenoid biosynthesis, non-mevalonate pathway

Protein Sequence

MMRIGHGFDVHAFGGEGPIVIAGVRIPYEQGLLAHSDGDVALHAATDALLGAAALGDIGKLFPDTDPAYKGADSRVLLREAFRRIQEKGYRLGNLDVTIIAQAPKMLPHIPQMRVNLAEDLQCHMDDINVKATTTEKLGFTGRKEGIACEAVALLVKAEA

Flanking regions ( +/- flanking 50bp)

CTCGCACTTGCCGGGTTCTACCTGTCCAATAACAATAAGGAACAGACAACATGATGAGAATCGGACACGGTTTTGATGTTCATGCCTTCGGCGGCGAAGGCCCGATTGTGATTGCGGGCGTCCGCATTCCTTACGAACAGGGATTACTGGCGCATTCCGACGGTGATGTCGCTCTGCATGCGGCCACCGACGCATTGCTGGGTGCGGCGGCGCTGGGGGATATCGGCAAATTATTCCCCGATACGGATCCGGCCTATAAAGGCGCGGACAGCCGTGTGCTGCTGCGTGAGGCATTCCGCCGTATTCAGGAAAAAGGCTACAGACTGGGTAACCTGGATGTCACCATTATCGCCCAGGCACCGAAAATGCTGCCGCATATCCCGCAGATGCGGGTGAATCTGGCGGAAGATTTGCAGTGTCATATGGATGATATCAATGTGAAAGCCACTACCACCGAGAAACTGGGTTTCACCGGCCGCAAAGAAGGGATCGCCTGTGAGGCGGTGGCGCTGCTTGTGAAGGCTGAAGCATGAGTCTCCCGGTCAGCTATTTTCACGGTAAACCGGCGGCCACCGGGGTACTG