Homologs in group_2353

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18995 FBDBKF_18995 94.3 Morganella morganii S1 ispF 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
EHELCC_18740 EHELCC_18740 94.3 Morganella morganii S2 ispF 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
NLDBIP_18565 NLDBIP_18565 94.3 Morganella morganii S4 ispF 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
LHKJJB_18610 LHKJJB_18610 94.3 Morganella morganii S3 ispF 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
HKOGLL_18345 HKOGLL_18345 94.3 Morganella morganii S5 ispF 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
PMI_RS11040 PMI_RS11040 85.5 Proteus mirabilis HI4320 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

Distribution of the homologs in the orthogroup group_2353

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2353

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8G9Z3 1.06e-98 283 87 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Serratia proteamaculans (strain 568)
C6DDG1 1.95e-98 283 87 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D1B4 2.11e-98 283 86 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1JJF7 2.39e-98 283 86 1 161 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EC2 2.39e-98 283 86 1 161 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPZ8 2.39e-98 283 86 1 161 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pestis (strain Pestoides F)
Q1CLR5 2.39e-98 283 86 1 161 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R118 2.39e-98 283 86 1 161 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBP7 2.39e-98 283 86 1 161 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pestis
Q1C477 2.39e-98 283 86 1 161 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLX7 2.39e-98 283 86 1 161 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JJT5 2.5e-97 280 85 1 161 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2K578 4.63e-97 280 86 1 161 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7MJ58 4.82e-96 277 85 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cronobacter sakazakii (strain ATCC BAA-894)
Q2NVM3 2.24e-94 273 82 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Sodalis glossinidius (strain morsitans)
B2VFZ6 2.69e-94 272 82 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q7N8K6 4.51e-94 272 90 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4F226 6.43e-93 269 87 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Proteus mirabilis (strain HI4320)
C5BGJ0 3.4e-92 267 82 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Edwardsiella ictaluri (strain 93-146)
Q8Z472 1.3e-90 263 86 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella typhi
B4TTW0 1.3e-90 263 86 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella schwarzengrund (strain CVM19633)
B5BEY3 1.3e-90 263 86 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella paratyphi A (strain AKU_12601)
C0PXA6 1.3e-90 263 86 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella paratyphi C (strain RKS4594)
A9N2D2 1.3e-90 263 86 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PEG2 1.3e-90 263 86 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T456 1.3e-90 263 86 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella newport (strain SL254)
B4TFW6 1.3e-90 263 86 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella heidelberg (strain SL476)
B5F410 1.3e-90 263 86 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella agona (strain SL483)
Q3YYB6 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shigella sonnei (strain Ss046)
P62619 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shigella flexneri
Q0T1H7 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shigella flexneri serotype 5b (strain 8401)
Q32CI4 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q31XA8 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shigella boydii serotype 4 (strain Sb227)
B2TZI5 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LWK9 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I6D6 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli (strain SE11)
B7N6X6 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P62617 2.35e-90 263 85 0 159 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli (strain K12)
B1IUT3 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A3M5 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O9:H4 (strain HS)
B1XCS2 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli (strain K12 / DH10B)
C4ZZQ0 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LXF8 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O8 (strain IAI1)
B7NT90 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z3A8 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P62618 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O157:H7
B7LEG4 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli (strain 55989 / EAEC)
A7ZQJ0 2.35e-90 263 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
A8ANW0 2.95e-90 262 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B1LQ66 2.99e-90 262 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli (strain SMS-3-5 / SECEC)
Q8FEJ6 2.99e-90 262 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MZ47 2.99e-90 262 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O81 (strain ED1a)
Q8ZMF7 5.28e-90 261 85 0 159 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B7UHG5 5.9e-90 261 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q57KJ5 7.1e-90 261 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella choleraesuis (strain SC-B67)
A9MF29 1.14e-89 261 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5RDQ2 1.2e-89 261 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QW17 1.2e-89 261 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella enteritidis PT4 (strain P125109)
B5FTS4 1.2e-89 261 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salmonella dublin (strain CT_02021853)
A4WDV1 2.48e-89 260 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Enterobacter sp. (strain 638)
Q1R7U5 2.83e-89 260 84 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli (strain UTI89 / UPEC)
A1AEU0 2.83e-89 260 84 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O1:K1 / APEC
B7MKM0 2.83e-89 260 84 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
B5XV35 3.12e-89 259 85 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Klebsiella pneumoniae (strain 342)
Q0TEB2 3.6e-89 259 84 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A6TD38 3.68e-89 259 87 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P44815 1.39e-83 245 73 0 156 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UE60 1.39e-83 245 73 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Haemophilus influenzae (strain PittEE)
A5UHG0 3.29e-83 244 73 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Haemophilus influenzae (strain PittGG)
Q4QMP5 1.21e-82 243 73 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Haemophilus influenzae (strain 86-028NP)
B5FAF6 8.83e-82 241 72 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Aliivibrio fischeri (strain MJ11)
Q5E329 2.29e-81 240 71 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EKL5 2.4e-81 240 73 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Aliivibrio salmonicida (strain LFI1238)
Q65Q79 5.16e-81 239 72 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A7MTS5 3.79e-79 234 71 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Vibrio campbellii (strain ATCC BAA-1116)
Q7MHQ5 4.27e-79 234 71 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Vibrio vulnificus (strain YJ016)
A6VQY0 6.13e-79 234 71 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q47956 1.05e-78 233 71 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q87LQ3 1.28e-78 233 71 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8DC59 2.03e-78 232 70 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Vibrio vulnificus (strain CMCP6)
Q6LMT4 1.59e-77 230 70 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Photobacterium profundum (strain SS9)
B3H1E2 4.86e-77 229 69 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0URU8 1.06e-76 228 76 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Histophilus somni (strain 2336)
B0BP83 1.09e-76 228 69 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N0G3 1.09e-76 228 69 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
P57954 1.26e-76 228 76 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pasteurella multocida (strain Pm70)
B8F4V8 2.34e-76 228 68 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Glaesserella parasuis serovar 5 (strain SH0165)
A1S4E0 5.48e-76 226 68 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q0I5H9 8.79e-76 226 75 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Histophilus somni (strain 129Pt)
A8H1S8 2.74e-75 224 68 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TK07 9.99e-75 223 69 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella halifaxensis (strain HAW-EB4)
Q15P30 1.14e-74 223 68 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A9KYG7 2.86e-74 222 69 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella baltica (strain OS195)
A6WR25 2.86e-74 222 69 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella baltica (strain OS185)
A3D792 2.86e-74 222 69 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A3QC80 3.23e-74 222 69 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q0HXG7 5.77e-74 221 69 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella sp. (strain MR-7)
Q0HL69 5.77e-74 221 69 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella sp. (strain MR-4)
A0KU85 5.77e-74 221 69 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella sp. (strain ANA-3)
Q8EBR3 8.65e-74 221 69 0 156 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1RHF6 1.03e-73 221 67 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella sp. (strain W3-18-1)
A4Y940 1.03e-73 221 67 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B8E8T4 4.38e-73 219 68 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella baltica (strain OS223)
B8CJP9 9.32e-73 218 65 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q2SKW6 1.86e-72 218 69 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Hahella chejuensis (strain KCTC 2396)
Q12PZ1 9.1e-72 216 66 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B1KPT3 1.59e-71 215 65 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella woodyi (strain ATCC 51908 / MS32)
Q3IDQ5 3.17e-71 214 66 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudoalteromonas translucida (strain TAC 125)
A4VJV0 8.05e-71 213 67 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Stutzerimonas stutzeri (strain A1501)
Q086A7 1.75e-70 212 65 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella frigidimarina (strain NCIMB 400)
C3LS19 2.54e-70 212 72 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Vibrio cholerae serotype O1 (strain M66-2)
Q9KUJ1 2.54e-70 212 72 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F9D7 2.54e-70 212 72 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A8FST1 4.85e-70 211 70 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shewanella sediminis (strain HAW-EB3)
A4XWR4 5.29e-70 211 67 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas mendocina (strain ymp)
Q48F85 1.62e-69 210 66 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q21LB9 1.77e-69 209 68 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B1JB32 2.1e-69 209 67 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas putida (strain W619)
Q02R99 2.48e-69 209 66 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B8GQ78 4.38e-69 209 65 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q886L7 6.29e-69 208 66 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A6V1G1 7.1e-69 208 66 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas aeruginosa (strain PA7)
P57708 1.35e-68 207 66 0 155 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V8C1 1.35e-68 207 66 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas aeruginosa (strain LESB58)
Q4KHF0 1.38e-68 207 66 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C1DSS0 2.19e-68 207 64 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
C3K703 2.37e-68 207 65 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas fluorescens (strain SBW25)
Q3KH86 3.4e-68 206 66 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas fluorescens (strain Pf0-1)
Q88MF3 4.93e-68 206 65 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W823 4.93e-68 206 65 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0KSC5 5.94e-68 206 65 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas putida (strain GB-1)
Q487E8 8.99e-68 206 61 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q4ZWQ2 1.25e-67 205 66 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas syringae pv. syringae (strain B728a)
Q1I652 1.38e-67 205 65 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudomonas entomophila (strain L48)
A7GJZ8 3.17e-67 204 64 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q5QUC4 9.27e-67 203 62 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q73FC0 4.11e-66 201 63 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
A9VN99 6.37e-66 201 62 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus mycoides (strain KBAB4)
Q6HPT1 6.37e-66 201 62 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63HB3 6.37e-66 201 62 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain ZK / E33L)
Q81J62 6.37e-66 201 62 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IZH1 6.37e-66 201 62 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain Q1)
B7HQS1 6.37e-66 201 62 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain AH187)
C1ET16 6.37e-66 201 62 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain 03BB102)
B7ISZ6 6.37e-66 201 62 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain G9842)
B7JK94 6.37e-66 201 62 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain AH820)
Q81VV4 6.37e-66 201 62 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus anthracis
A0R8F8 6.37e-66 201 62 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus thuringiensis (strain Al Hakam)
C3LJ59 6.37e-66 201 62 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9N2 6.37e-66 201 62 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus anthracis (strain A0248)
B7HJ25 2.59e-65 199 62 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus cereus (strain B4264)
Q1QU74 1.18e-64 197 63 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
C5D3P3 6.61e-64 196 61 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Geobacillus sp. (strain WCH70)
Q39ZL6 6.83e-64 196 63 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B3PJB0 9.17e-64 195 62 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cellvibrio japonicus (strain Ueda107)
Q8K9D7 9.34e-64 196 53 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B2JGK3 1.15e-62 192 60 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B8D7U9 1.59e-62 192 54 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57494 1.59e-62 192 54 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9J7 1.59e-62 192 54 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q747A0 3.18e-62 191 62 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q65PD1 5.74e-62 191 61 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A9AIT6 6.12e-62 191 59 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia multivorans (strain ATCC 17616 / 249)
Q39FB9 9.38e-62 190 60 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B2T3X3 1.25e-61 190 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q493M8 1.35e-61 190 57 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Blochmanniella pennsylvanica (strain BPEN)
C1KYG9 1.89e-61 189 57 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q9KGF7 1.92e-61 189 60 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q3SK37 2.25e-61 189 57 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Thiobacillus denitrificans (strain ATCC 25259)
Q13Z30 2.36e-61 189 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Paraburkholderia xenovorans (strain LB400)
Q63T71 2.89e-61 189 58 0 158 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia pseudomallei (strain K96243)
A3NAL8 2.89e-61 189 58 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia pseudomallei (strain 668)
Q3JRA0 2.89e-61 189 58 0 158 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia pseudomallei (strain 1710b)
A3NWD9 2.89e-61 189 58 0 158 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia pseudomallei (strain 1106a)
A1V4Z9 2.89e-61 189 58 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia mallei (strain SAVP1)
Q62JI6 2.89e-61 189 58 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia mallei (strain ATCC 23344)
A2SBD7 2.89e-61 189 58 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia mallei (strain NCTC 10229)
A3MKM3 2.89e-61 189 58 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia mallei (strain NCTC 10247)
A7Z0L3 3.2e-61 189 60 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B2UFT6 3.67e-61 189 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Ralstonia pickettii (strain 12J)
Q2SWT5 3.97e-61 189 58 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q0KBM9 5.99e-61 188 58 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A5G939 6.11e-61 188 62 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Geotalea uraniireducens (strain Rf4)
Q724H6 7.77e-61 188 57 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Listeria monocytogenes serotype 4b (strain F2365)
B1YS10 8.94e-61 188 59 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia ambifaria (strain MC40-6)
Q0BED7 1.03e-60 187 59 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q1LLZ4 1.28e-60 187 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q604M1 1.37e-60 187 60 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B8DF19 1.48e-60 187 57 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Listeria monocytogenes serotype 4a (strain HCC23)
Q0SQN0 1.55e-60 187 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium perfringens (strain SM101 / Type A)
B3R4U4 1.89e-60 187 58 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0VQD3 2.34e-60 187 60 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q8XI08 2.37e-60 186 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium perfringens (strain 13 / Type A)
Q0TMY4 2.37e-60 186 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8YAB4 2.62e-60 186 57 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
A1K645 2.73e-60 186 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Azoarcus sp. (strain BH72)
Q1BHA4 3.29e-60 186 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia orbicola (strain AU 1054)
B1JTX0 3.29e-60 186 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia orbicola (strain MC0-3)
B4EC22 3.29e-60 186 58 0 156 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K866 3.29e-60 186 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia cenocepacia (strain HI2424)
A4JF19 3.4e-60 186 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Burkholderia vietnamiensis (strain G4 / LMG 22486)
B1HNM6 5.04e-60 186 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Lysinibacillus sphaericus (strain C3-41)
Q8XYW2 7.67e-60 186 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q06756 1.22e-59 185 58 0 156 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus subtilis (strain 168)
Q18CD3 1.23e-59 185 54 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridioides difficile (strain 630)
Q5F830 1.36e-59 185 54 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q92F39 2.03e-59 184 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q0A7K7 2.56e-59 184 56 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q9JTM4 3.2e-59 184 54 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A1KUU9 3.53e-59 184 54 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JYM5 3.53e-59 184 54 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M0U6 3.53e-59 184 54 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Neisseria meningitidis serogroup C (strain 053442)
B0TYX5 3.61e-59 184 57 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q5NYK0 4.83e-59 184 57 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B3E280 5.08e-59 183 61 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q3JCS8 6.38e-59 183 56 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q2KUX6 6.65e-59 183 57 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bordetella avium (strain 197N)
Q3A8C7 1.46e-58 182 60 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q472F1 1.87e-58 182 56 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A1AJY3 5.05e-58 181 60 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A8MLB2 5.89e-58 181 62 0 145 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Alkaliphilus oremlandii (strain OhILAs)
A8F959 1.35e-57 179 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacillus pumilus (strain SAFR-032)
Q82US7 2.77e-57 179 59 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A0Q6Y1 3.17e-57 179 56 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella tularensis subsp. novicida (strain U112)
Q1H2A2 4.54e-57 178 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
C1D559 5.76e-57 178 57 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Laribacter hongkongensis (strain HLHK9)
A4IJG5 7.18e-57 178 57 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Geobacillus thermodenitrificans (strain NG80-2)
Q2Y752 9.26e-57 178 57 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A1TZ51 1.63e-56 177 61 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B9LZW2 2.05e-56 177 58 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q3A9N8 2.6e-56 176 54 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q5WLT6 6.4e-56 175 55 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Shouchella clausii (strain KSM-K16)
A4IYG6 6.54e-56 175 56 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella tularensis subsp. tularensis (strain WY96-3418)
B2SDD4 6.54e-56 175 56 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A3Z7 6.54e-56 175 56 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella tularensis subsp. holarctica (strain LVS)
A7NBK5 6.54e-56 175 56 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q839V8 7.48e-56 175 51 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Enterococcus faecalis (strain ATCC 700802 / V583)
Q5L432 9.5e-56 175 57 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Geobacillus kaustophilus (strain HTA426)
Q0BMD2 1.64e-55 174 55 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella tularensis subsp. holarctica (strain OSU18)
B0V6G3 2.65e-55 174 55 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acinetobacter baumannii (strain AYE)
A3M665 2.65e-55 174 55 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2I336 2.65e-55 174 55 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acinetobacter baumannii (strain ACICU)
B7I9W0 2.65e-55 174 55 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acinetobacter baumannii (strain AB0057)
B7H1F3 2.65e-55 174 55 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acinetobacter baumannii (strain AB307-0294)
Q5NFU1 2.74e-55 174 55 1 157 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14H93 2.74e-55 174 55 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Francisella tularensis subsp. tularensis (strain FSC 198)
B0S2Q7 3.8e-55 173 53 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
B0VMT6 4.83e-55 173 55 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acinetobacter baumannii (strain SDF)
Q0AGI1 5.9e-55 173 58 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A9II47 6.13e-55 173 53 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A6TWK9 7.66e-55 172 57 0 152 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Alkaliphilus metalliredigens (strain QYMF)
A4J0Y4 4.76e-54 171 54 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B2RGP8 6.29e-54 171 54 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
A5N3R3 9.1e-54 170 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DXE4 9.1e-54 170 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium kluyveri (strain NBRC 12016)
Q6FAU4 1.21e-53 170 54 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
C4Z3N3 1.44e-53 170 54 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
A0LIS1 1.9e-53 169 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q7MXX0 2.28e-53 169 53 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q899E9 7.56e-53 167 53 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium tetani (strain Massachusetts / E88)
B3QV82 1.15e-52 167 53 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A6LF29 1.15e-52 167 50 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q0AUF5 1.4e-52 167 52 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B3QPS3 1.57e-52 167 53 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q97LX0 4.17e-52 166 50 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B3EMU1 7.91e-52 165 51 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chlorobium phaeobacteroides (strain BS1)
C4Z8W9 8.02e-52 166 52 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
B9KSH9 1.31e-51 164 53 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3J2K8 1.31e-51 164 53 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PJQ4 1.31e-51 164 53 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q21YT7 1.55e-51 172 55 0 156 3 ispDF Bifunctional enzyme IspD/IspF Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B2UYW8 2.39e-51 164 50 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain Alaska E43 / Type E3)
Q165P5 2.46e-51 164 50 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q7VZN1 4.88e-51 163 57 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W5D0 4.88e-51 163 57 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
C1FQ26 5.21e-51 163 52 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain Kyoto / Type A2)
B1ID41 5.62e-51 163 52 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain Okra / Type B1)
C3KXW6 5.94e-51 162 52 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain 657 / Type Ba4)
B1KRX5 6.63e-51 162 52 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain Loch Maree / Type A3)
A7G9H1 6.63e-51 162 52 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5HXW3 6.63e-51 162 52 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FQ95 6.63e-51 162 52 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain ATCC 19397 / Type A)
A4WSL4 6.66e-51 162 51 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q8YQF0 9.55e-51 162 51 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8PLR7 1.37e-50 162 50 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xanthomonas axonopodis pv. citri (strain 306)
A0Q3K0 1.42e-50 162 50 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium novyi (strain NT)
Q3MC53 1.51e-50 162 51 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B2JA49 1.59e-50 162 49 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A4XJU4 3.02e-50 161 48 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q8KC25 3.05e-50 161 53 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8P9Z0 3.44e-50 161 50 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU02 3.44e-50 161 50 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xanthomonas campestris pv. campestris (strain B100)
Q4UTP5 3.44e-50 161 50 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xanthomonas campestris pv. campestris (strain 8004)
Q5GYK7 3.48e-50 161 50 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SUA9 3.48e-50 161 50 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P1L1 3.48e-50 161 50 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2A4B2 5.86e-50 160 50 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q7WCW4 7.65e-50 160 56 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B8HVI5 8.27e-50 160 50 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q3BUS7 1.28e-49 160 50 0 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B6YRV8 2.02e-49 159 46 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Azobacteroides pseudotrichonymphae genomovar. CFP2
Q7NYL5 3.48e-49 158 54 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q6ARN9 4.62e-49 165 51 0 154 3 ispDF Bifunctional enzyme IspD/IspF Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A6LQ55 4.98e-49 158 53 0 145 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q0C0N0 5.16e-49 164 54 0 154 3 ispDF Bifunctional enzyme IspD/IspF Hyphomonas neptunium (strain ATCC 15444)
Q87DY3 7.52e-49 158 48 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B4S5L1 8.53e-49 157 50 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q2GIK8 1.18e-48 157 47 2 161 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Anaplasma phagocytophilum (strain HZ)
C0R0Y4 1.25e-48 157 47 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q250Q9 1.36e-48 157 54 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Desulfitobacterium hafniense (strain Y51)
B8G1T9 1.36e-48 157 54 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q9PDT5 1.46e-48 157 48 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Xylella fastidiosa (strain 9a5c)
Q5L8X2 1.55e-48 157 50 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A7ZCQ2 1.61e-48 163 58 0 148 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter concisus (strain 13826)
A6Q7M3 1.81e-48 163 52 0 152 3 ispDF Bifunctional enzyme IspD/IspF Sulfurovum sp. (strain NBC37-1)
Q64P34 1.84e-48 156 50 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacteroides fragilis (strain YCH46)
A1WWY9 1.87e-48 157 54 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Halorhodospira halophila (strain DSM 244 / SL1)
Q8DHC4 1.92e-48 156 50 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B9KEX3 2.55e-48 162 54 0 151 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q8A0Y7 2.64e-48 156 50 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q8D224 2.65e-48 156 44 2 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Wigglesworthia glossinidia brevipalpis
A6L0V6 3.11e-48 156 51 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A7H5V8 3.87e-48 162 52 0 151 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FNR8 4.26e-48 162 52 0 151 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q5HSI4 4.45e-48 162 52 0 151 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter jejuni (strain RM1221)
A1W1K9 4.5e-48 162 52 0 151 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PM68 4.65e-48 162 52 0 151 1 ispDF Bifunctional enzyme IspD/IspF Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q2GHV0 7.09e-48 155 49 1 161 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q1QBM3 8.26e-48 155 57 1 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q67JP6 1.94e-47 154 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B2TIU0 2.38e-47 154 48 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Clostridium botulinum (strain Eklund 17B / Type B)
A7GZI1 2.52e-47 160 56 0 144 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter curvus (strain 525.92)
B8FHQ6 2.58e-47 153 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Desulfatibacillum aliphaticivorans
B8D0A0 2.88e-47 154 47 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q11Q93 4.14e-47 153 46 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q7MQW9 4.87e-47 159 57 2 152 3 ispDF Bifunctional enzyme IspD/IspF Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q5N549 6.46e-47 152 48 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31P19 6.46e-47 152 48 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A0RN28 6.61e-47 159 52 0 151 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter fetus subsp. fetus (strain 82-40)
Q9M4W3 8.69e-47 155 48 0 156 2 ISPF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic Catharanthus roseus
Q1GGW9 9.07e-47 159 48 0 156 3 ispDF Bifunctional enzyme IspD/IspF Ruegeria sp. (strain TM1040)
Q4FSB5 9.41e-47 152 57 1 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A8ER37 1.37e-46 158 49 0 151 3 ispDF Bifunctional enzyme IspD/IspF Aliarcobacter butzleri (strain RM4018)
P73426 1.49e-46 152 48 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9CAK8 1.5e-46 154 48 0 156 1 ISPF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic Arabidopsis thaliana
Q3YT02 1.89e-46 152 48 1 161 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Ehrlichia canis (strain Jake)
Q6EPN6 2.24e-46 153 48 0 156 1 ISPF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic Oryza sativa subsp. japonica
A4SFZ0 2.66e-46 151 48 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A1B890 2.69e-46 157 48 0 156 3 ispDF Bifunctional enzyme IspD/IspF Paracoccus denitrificans (strain Pd 1222)
B9MRD4 3.31e-46 150 45 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
C1A8W3 3.42e-46 151 45 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
Q8R7S8 5.37e-46 150 48 1 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q2JNA9 1.06e-45 149 48 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q2JXJ4 1.06e-45 149 48 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Synechococcus sp. (strain JA-3-3Ab)
Q3APP2 1.11e-45 149 51 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chlorobium chlorochromatii (strain CaD3)
Q0BTD5 1.64e-45 155 50 0 154 3 ispDF Bifunctional enzyme IspD/IspF Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q1AU09 3.74e-45 148 51 3 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
A6Q2K0 4.32e-45 154 51 0 153 3 ispDF Bifunctional enzyme IspD/IspF Nitratiruptor sp. (strain SB155-2)
A1WR07 6.56e-45 148 53 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Verminephrobacter eiseniae (strain EF01-2)
Q2GER2 7.62e-45 147 47 2 164 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q5P993 8.88e-45 148 47 1 161 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Anaplasma marginale (strain St. Maries)
Q8R6E7 9.88e-45 147 47 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q2NAE1 1.02e-44 154 49 0 156 3 ispDF Bifunctional enzyme IspD/IspF Erythrobacter litoralis (strain HTCC2594)
Q7VFU3 1.3e-44 153 52 0 150 3 ispDF Bifunctional enzyme IspD/IspF Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q3B2H9 1.43e-44 147 48 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q2LUT1 1.84e-44 146 46 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Syntrophus aciditrophicus (strain SB)
A7I1V2 2.07e-44 152 53 1 144 3 ispDF Bifunctional enzyme IspD/IspF Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A1BE20 4.42e-44 145 47 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B0CBC9 5.17e-44 145 45 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acaryochloris marina (strain MBIC 11017)
Q5LRN5 5.41e-44 151 44 0 156 3 ispDF Bifunctional enzyme IspD/IspF Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q47EL1 5.97e-44 145 52 0 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Dechloromonas aromatica (strain RCB)
Q2RFM1 1.05e-43 144 56 0 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q92Q90 1.17e-43 151 49 0 159 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium meliloti (strain 1021)
B4SE23 1.25e-43 144 48 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q08113 1.4e-43 150 46 0 155 3 ispDF Bifunctional enzyme IspD/IspF Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
A5D5L5 1.44e-43 144 47 0 159 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q0IC27 2.02e-43 144 47 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Synechococcus sp. (strain CC9311)
Q7UU80 2.13e-43 144 47 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A8LKV5 2.72e-43 150 43 0 157 3 ispDF Bifunctional enzyme IspD/IspF Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B1GYT3 4.74e-43 143 45 0 151 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Endomicrobium trichonymphae
B3PYS4 4.89e-43 149 48 0 155 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium etli (strain CIAT 652)
Q89LQ8 7.73e-43 149 49 0 150 3 ispDF Bifunctional enzyme IspD/IspF Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q30QG7 8.65e-43 149 51 0 143 3 ispDF Bifunctional enzyme IspD/IspF Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A7HXV6 9.36e-43 148 46 0 154 3 ispDF Bifunctional enzyme IspD/IspF Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A8IBL6 1.18e-42 148 51 0 150 3 ispDF Bifunctional enzyme IspD/IspF Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q8YHD8 1.2e-42 148 47 0 155 3 ispDF Bifunctional enzyme IspD/IspF Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57D18 1.2e-42 148 47 0 155 3 ispDF Bifunctional enzyme IspD/IspF Brucella abortus biovar 1 (strain 9-941)
Q2YPW1 1.2e-42 148 47 0 155 3 ispDF Bifunctional enzyme IspD/IspF Brucella abortus (strain 2308)
A5VQP4 1.33e-42 149 47 0 155 3 ispDF Bifunctional enzyme IspD/IspF Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q3SSN8 1.86e-42 148 48 0 154 3 ispDF Bifunctional enzyme IspD/IspF Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A5EIY9 2.09e-42 147 49 0 150 3 ispDF Bifunctional enzyme IspD/IspF Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q9RNZ1 2.35e-42 147 51 0 149 3 ispDF Bifunctional enzyme IspD/IspF Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q3ZAD6 2.45e-42 141 46 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q1QM99 2.62e-42 147 49 0 150 3 ispDF Bifunctional enzyme IspD/IspF Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q137C3 3.92e-42 147 49 0 150 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain BisB5)
A4YUQ7 4.21e-42 147 49 0 150 3 ispDF Bifunctional enzyme IspD/IspF Bradyrhizobium sp. (strain ORS 278)
Q2IQG8 6.05e-42 146 48 1 155 3 ispDF Bifunctional enzyme IspD/IspF Anaeromyxobacter dehalogenans (strain 2CP-C)
Q3ZWG5 6.4e-42 140 46 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Dehalococcoides mccartyi (strain CBDB1)
Q07MZ2 6.45e-42 146 48 0 154 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain BisA53)
Q04XV1 6.61e-42 140 43 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04VM3 6.61e-42 140 43 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q2K8V5 7.66e-42 146 47 0 155 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B8GW85 8.28e-42 146 49 0 151 3 ispDF Bifunctional enzyme IspD/IspF Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A7I5 8.28e-42 146 49 0 151 3 ispDF Bifunctional enzyme IspD/IspF Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q214R1 8.77e-42 146 48 0 154 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain BisB18)
B5ZNB6 8.79e-42 146 47 0 155 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q2G708 9.75e-42 146 50 0 155 3 ispDF Bifunctional enzyme IspD/IspF Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q2RTS1 1.06e-41 145 49 0 154 3 ispDF Bifunctional enzyme IspD/IspF Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B3QIL5 1.07e-41 146 49 0 150 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain TIE-1)
Q6N6M5 1.11e-41 146 49 0 150 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q98MX9 1.22e-41 146 47 0 155 3 ispDF Bifunctional enzyme IspD/IspF Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2S211 1.65e-41 139 50 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salinibacter ruber (strain DSM 13855 / M31)
Q2IW23 2.12e-41 145 48 0 150 3 ispDF Bifunctional enzyme IspD/IspF Rhodopseudomonas palustris (strain HaA2)
Q8G0H4 2.17e-41 145 46 0 155 3 ispDF Bifunctional enzyme IspD/IspF Brucella suis biovar 1 (strain 1330)
A6X0N1 2.53e-41 145 46 0 155 3 ispDF Bifunctional enzyme IspD/IspF Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q1MH21 3.24e-41 145 47 0 155 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A6U8F8 3.89e-41 144 49 0 155 3 ispDF Bifunctional enzyme IspD/IspF Sinorhizobium medicae (strain WSM419)
Q6G164 8.15e-41 144 45 0 155 3 ispDF Bifunctional enzyme IspD/IspF Bartonella quintana (strain Toulouse)
B9JF01 8.37e-41 144 46 0 155 3 ispDF Bifunctional enzyme IspD/IspF Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A1USA2 8.66e-41 144 46 0 155 3 ispDF Bifunctional enzyme IspD/IspF Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q73G24 9.52e-41 143 45 1 159 3 ispDF Bifunctional enzyme IspD/IspF Wolbachia pipientis wMel
A8G687 1.23e-40 137 43 1 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Prochlorococcus marinus (strain MIT 9215)
Q5GSM7 1.6e-40 143 46 1 162 3 ispDF Bifunctional enzyme IspD/IspF Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q28Q60 1.63e-40 142 44 0 155 3 ispDF Bifunctional enzyme IspD/IspF Jannaschia sp. (strain CCS1)
Q319L1 8.09e-40 135 43 1 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Prochlorococcus marinus (strain MIT 9312)
Q310X3 9.7e-40 141 47 2 159 3 ispDF Bifunctional enzyme IspD/IspF Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A9IS87 1e-39 141 46 0 151 3 ispDF Bifunctional enzyme IspD/IspF Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q7NFH8 2.25e-39 134 47 0 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q1IVA8 2.34e-39 133 44 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Koribacter versatilis (strain Ellin345)
Q027G2 2.72e-39 133 46 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Solibacter usitatus (strain Ellin6076)
Q1GTN0 3.63e-39 139 48 0 152 3 ispDF Bifunctional enzyme IspD/IspF Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q11HV9 4.3e-39 139 44 0 145 3 ispDF Bifunctional enzyme IspD/IspF Chelativorans sp. (strain BNC1)
Q6G3Z8 4.66e-39 139 45 0 151 3 ispDF Bifunctional enzyme IspD/IspF Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q5HC74 5.74e-39 133 45 1 162 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Ehrlichia ruminantium (strain Welgevonden)
Q5FQD6 7.61e-39 138 46 0 154 3 ispDF Bifunctional enzyme IspD/IspF Gluconobacter oxydans (strain 621H)
Q4FM31 1.05e-38 137 42 0 156 3 ispDF Bifunctional enzyme IspD/IspF Pelagibacter ubique (strain HTCC1062)
A9A0H0 1.06e-38 132 48 0 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
B6JL03 1.64e-38 138 46 0 150 3 ispDF Bifunctional enzyme IspD/IspF Helicobacter pylori (strain P12)
O25664 1.71e-38 138 46 0 150 1 ispDF Bifunctional enzyme IspD/IspF Helicobacter pylori (strain ATCC 700392 / 26695)
B2USR1 1.72e-38 138 46 0 150 3 ispDF Bifunctional enzyme IspD/IspF Helicobacter pylori (strain Shi470)
Q9ZM19 2.02e-38 137 46 0 150 3 ispDF Bifunctional enzyme IspD/IspF Helicobacter pylori (strain J99 / ATCC 700824)
Q1CU78 2.17e-38 137 46 0 150 3 ispDF Bifunctional enzyme IspD/IspF Helicobacter pylori (strain HPAG1)
B1I0S9 3.08e-38 137 48 0 139 3 ispDF Bifunctional enzyme IspD/IspF Desulforudis audaxviator (strain MP104C)
Q5FF92 3.41e-38 131 45 1 162 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Ehrlichia ruminantium (strain Gardel)
Q8UFF4 3.53e-38 137 44 0 155 3 ispDF Bifunctional enzyme IspD/IspF Agrobacterium fabrum (strain C58 / ATCC 33970)
Q17WU1 3.96e-38 137 46 0 148 3 ispDF Bifunctional enzyme IspD/IspF Helicobacter acinonychis (strain Sheeba)
B9JW91 5.88e-38 136 46 0 155 3 ispDF Bifunctional enzyme IspD/IspF Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q2W4Q8 6.05e-38 136 49 1 152 3 ispDF Bifunctional enzyme IspD/IspF Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q8F0A5 7e-38 130 43 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72UP7 1.05e-37 129 43 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B5Z6H4 1.69e-37 135 46 0 150 3 ispDF Bifunctional enzyme IspD/IspF Helicobacter pylori (strain G27)
A5V2U9 4.34e-37 134 47 0 153 3 ispDF Bifunctional enzyme IspD/IspF Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B0SJL7 1.69e-36 126 42 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SAT2 1.69e-36 126 42 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q47KT3 1.85e-36 126 44 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Thermobifida fusca (strain YX)
Q0APQ6 1.56e-35 129 46 0 149 3 ispDF Bifunctional enzyme IspD/IspF Maricaulis maris (strain MCS10)
Q73KC6 1.81e-35 124 45 0 133 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
O67089 3.55e-35 122 42 2 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Aquifex aeolicus (strain VF5)
A7HDA2 3.57e-35 129 49 1 155 3 ispDF Bifunctional enzyme IspD/IspF Anaeromyxobacter sp. (strain Fw109-5)
O83525 6.72e-35 128 41 0 157 3 ispDF Bifunctional enzyme IspD/IspF Treponema pallidum (strain Nichols)
C4XSW4 5.96e-34 125 44 1 157 3 ispDF Bifunctional enzyme IspD/IspF Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
B2URI3 4.91e-33 117 41 1 153 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q8RQP5 1.29e-32 116 43 1 154 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72HP8 1.29e-32 116 43 1 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q0RBN8 4.88e-32 115 40 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q2J543 5.21e-32 115 39 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q1MR76 5.28e-32 120 39 1 163 3 ispDF Bifunctional enzyme IspD/IspF Lawsonia intracellularis (strain PHE/MN1-00)
Q6ADI0 6.14e-32 120 42 1 154 3 ispDF Bifunctional enzyme IspD/IspF Leifsonia xyli subsp. xyli (strain CTCB07)
A4XCN1 8.89e-31 112 39 1 153 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A8LF85 2.24e-30 110 39 2 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Parafrankia sp. (strain EAN1pec)
B9KAZ0 8.95e-30 109 41 2 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q9WZB5 1.38e-29 108 41 2 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A1SNY6 5.79e-29 107 39 2 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Nocardioides sp. (strain ATCC BAA-499 / JS614)
A0LQZ7 8.23e-29 107 37 1 153 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
A1VDX6 8.45e-29 112 45 0 150 3 ispDF Bifunctional enzyme IspD/IspF Nitratidesulfovibrio vulgaris (strain DP4)
Q72C30 8.45e-29 112 45 0 150 3 ispDF Bifunctional enzyme IspD/IspF Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P62369 1.92e-28 108 36 3 174 1 IspF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, apicoplast Plasmodium falciparum (isolate HB3)
P62368 1.92e-28 108 36 3 174 1 IspF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, apicoplast Plasmodium falciparum (isolate 3D7)
Q9RXS6 2.35e-28 105 39 2 158 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q9CCW5 3.76e-28 105 39 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium leprae (strain TN)
B8ZUA8 3.76e-28 105 39 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium leprae (strain Br4923)
B2HJ22 5.7e-28 104 37 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium marinum (strain ATCC BAA-535 / M)
A8M7S7 1.12e-27 103 37 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Salinispora arenicola (strain CNS-205)
Q0S889 1.26e-27 103 38 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Rhodococcus jostii (strain RHA1)
Q6AAV7 1.78e-27 103 38 2 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Cutibacterium acnes (strain DSM 16379 / KPA171202)
P9WKG5 2.07e-27 103 37 1 156 1 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKG4 2.07e-27 103 37 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U8Q6 2.07e-27 103 37 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AI40 2.07e-27 103 37 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KPR7 2.07e-27 103 37 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P65184 2.07e-27 103 37 1 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
C1BAC3 5.22e-27 102 37 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Rhodococcus opacus (strain B4)
A5CTY4 6.19e-27 107 37 1 157 3 ispDF Bifunctional enzyme IspD/IspF Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
C0ZPR8 1.08e-26 101 37 1 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
A6W6E9 7.24e-26 99 38 2 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q5Z2R2 2.23e-25 97 38 1 154 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Nocardia farcinica (strain IFM 10152)
Q7NC56 6.13e-24 94 35 3 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
B8HCR6 7.69e-24 94 39 2 156 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A1TG10 1.23e-23 93 36 1 155 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
B1VS88 1.25e-23 94 35 2 157 3 ispF 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS13905
Feature type CDS
Gene ispF
Product 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
Location 418020 - 418499 (strand: -1)
Length 480 (nucleotides) / 159 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2353
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02542 YgbB family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0245 Lipid transport and metabolism (I) I 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01770 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:4.6.1.12] Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites		 C5 isoprenoid biosynthesis, non-mevalonate pathway

Protein Sequence

MRIGHGFDVHAFGGEGPIVIAGVRIPYEQGLLAHSDGDVALHAATDALLGAAAMGDIGKLFPDTDPAYKGADSRVLLREAFRRIQEKGYKLGNLDITIIAQAPKMLPHIPQMRVNLAEDLHCHMDDINVKATTTEKLGFVGRKEGIACEAVVLLVKVAQ

Flanking regions ( +/- flanking 50bp)

GCGCTTGCCGGGTTCTACCTGTCCAATAACAATAAGGAACAGACATAATGATGAGAATCGGACACGGTTTTGATGTTCATGCTTTCGGCGGCGAAGGCCCGATTGTGATTGCCGGTGTGCGCATCCCTTATGAACAGGGATTACTGGCACATTCTGATGGTGATGTTGCCTTGCATGCCGCGACAGATGCCTTATTAGGTGCGGCGGCGATGGGTGATATCGGTAAGTTATTTCCTGATACCGATCCCGCTTATAAAGGTGCGGACAGCCGTGTTTTACTGCGTGAAGCATTCCGGCGTATTCAGGAAAAAGGCTATAAACTGGGTAATCTGGATATCACTATTATTGCGCAGGCACCGAAAATGCTGCCGCATATCCCGCAGATGCGCGTTAATCTGGCAGAAGATTTACACTGCCACATGGATGACATCAATGTAAAGGCGACCACGACTGAAAAACTCGGCTTTGTCGGGCGCAAAGAAGGGATCGCCTGCGAAGCCGTCGTATTACTTGTTAAGGTCGCACAATGAGCCTGAATGTCAGCTGGTTTCACGGAAAACCGGTTGCGACCGGCGTATTA