Homologs in group_418

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20460 FBDBKF_20460 42.9 Morganella morganii S1 tetC tetracyline resistance-associated transcriptional repressor TetC
EHELCC_16965 EHELCC_16965 100.0 Morganella morganii S2 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
NLDBIP_18345 NLDBIP_18345 100.0 Morganella morganii S4 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
LHKJJB_09280 LHKJJB_09280 100.0 Morganella morganii S3 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
HKOGLL_08830 HKOGLL_08830 100.0 Morganella morganii S5 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
F4V73_RS13820 F4V73_RS13820 69.5 Morganella psychrotolerans - TetR/AcrR family transcriptional regulator
PMI_RS05690 PMI_RS05690 38.6 Proteus mirabilis HI4320 - TetR family transcriptional regulator

Distribution of the homologs in the orthogroup group_418

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_418

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P28815 1.36e-51 167 45 0 187 1 tetC Transposon Tn10 TetC protein Escherichia coli
P0ACT1 1.83e-07 52 46 0 60 3 acrR HTH-type transcriptional regulator AcrR Shigella flexneri
P0ACS9 1.83e-07 52 46 0 60 1 acrR HTH-type transcriptional regulator AcrR Escherichia coli (strain K12)
P0ACT0 1.83e-07 52 46 0 60 3 acrR HTH-type transcriptional regulator AcrR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q3J6K8 2.1e-07 52 36 4 94 1 acuR Transcriptional regulator AcuR Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q6GDM3 5.58e-07 51 31 1 89 4 SAR2658 HTH-type transcriptional regulator SAR2658 Staphylococcus aureus (strain MRSA252)
Q2FV42 5.87e-07 51 31 1 89 4 SAOUHSC_02897 HTH-type transcriptional regulator SAOUHSC_02897 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q5HCX3 5.87e-07 51 31 1 89 4 SACOL2593 HTH-type transcriptional regulator SACOL2593 Staphylococcus aureus (strain COL)
Q2FDS9 5.87e-07 51 31 1 89 4 SAUSA300_2515 HTH-type transcriptional regulator SAUSA300_2515 Staphylococcus aureus (strain USA300)
Q99R60 5.93e-07 51 31 1 89 4 SAV2578 HTH-type transcriptional regulator SAV2578 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q79ZX9 5.93e-07 51 31 1 89 4 MW2498 HTH-type transcriptional regulator MW2498 Staphylococcus aureus (strain MW2)
Q6G696 5.93e-07 51 31 1 89 4 SAS2464 HTH-type transcriptional regulator SAS2464 Staphylococcus aureus (strain MSSA476)
Q7A3C7 5.93e-07 51 31 1 89 4 SA2364 HTH-type transcriptional regulator SA2364 Staphylococcus aureus (strain N315)
P40950 9.3e-07 51 46 1 52 4 yuxN Uncharacterized HTH-type transcriptional regulator YuxN Bacillus subtilis (strain 168)
Q2YWD0 1.71e-06 49 29 1 91 4 SAB2452 HTH-type transcriptional regulator SAB2452 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8G2M8 3.86e-06 48 38 2 77 1 bepR HTH-type transcriptional repressor BepR Brucella suis biovar 1 (strain 1330)
P39601 8.46e-06 48 33 0 69 4 ywcC Uncharacterized HTH-type transcriptional regulator YwcC Bacillus subtilis (strain 168)
O31500 8.9e-06 48 52 0 42 4 yerO Uncharacterized HTH-type transcriptional regulator YerO Bacillus subtilis (strain 168)
P39897 1.04e-05 47 44 0 50 1 mtrR HTH-type transcriptional regulator MtrR Neisseria gonorrhoeae
P96676 4.22e-05 45 28 2 85 4 ydeS Uncharacterized HTH-type transcriptional regulator YdeS Bacillus subtilis (strain 168)
Q93PU7 5.58e-05 44 41 0 48 1 ttgW Uncharacterized HTH-type transcriptional regulator TtgW Pseudomonas putida (strain DOT-T1E)
Q9R9T9 8.42e-05 45 41 0 48 1 srpR HTH-type transcriptional regulator SrpR Pseudomonas putida
P94423 0.000243 44 33 0 63 4 ycnC Uncharacterized HTH-type transcriptional regulator YcnC Bacillus subtilis (strain 168)
O33453 0.000253 43 34 1 75 2 cymR HTH-type transcriptional regulator CymR Pseudomonas putida
P0A0N5 0.000266 43 35 0 57 1 qacR HTH-type transcriptional regulator QacR Staphylococcus haemolyticus
P0A0N4 0.000266 43 35 0 57 1 qacR HTH-type transcriptional regulator QacR Staphylococcus aureus
P0A0N3 0.000266 43 35 0 57 1 qacR HTH-type transcriptional regulator QacR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0ACT2 0.000276 43 38 0 49 4 envR Probable acrEF/envCD operon repressor Escherichia coli (strain K12)
P0ACT3 0.000276 43 38 0 49 3 envR Probable acrEF/envCD operon repressor Escherichia coli O157:H7
P67430 0.000293 43 38 0 44 1 nemR HTH-type transcriptional repressor NemR Escherichia coli (strain K12)
P67431 0.000293 43 38 0 44 3 nemR HTH-type transcriptional repressor NemR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P9WMB9 0.000321 43 25 2 107 1 kstR2 HTH-type transcriptional repressor KstR2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMB8 0.000321 43 25 2 107 3 kstR2 HTH-type transcriptional repressor KstR2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9RAJ1 0.000456 43 41 0 43 4 dhaR HTH-type transcriptional repressor DhaR Mycobacterium sp. (strain GP1)
Q9ZN78 0.000642 43 43 0 46 1 arpA A-factor receptor protein Streptomyces griseus
P95251 0.000669 43 44 0 47 1 mce3R Transcriptional repressor Mce3R Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_18770
Feature type CDS
Gene acrR
Product DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
Location 91 - 684 (strand: 1)
Length 594 (nucleotides) / 197 (amino acids)

Contig

Accession contig_36
Length 27638 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_418
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00440 Bacterial regulatory proteins, tetR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1309 Transcription (K) K DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19047 TetR/AcrR family transcriptional regulator, repressor of tetCD - -

Protein Sequence

MIFTKIIRGFIRTRQALLISAHGLFIEKGYQSVSIDEIARDARVTKGAFYHHFKSKSDLLLHCYEIQLQKISAVLDHIEPLADKWEELQLVVRSFMNYLEQHYRELIPVQEVMPVAGWYEFEDINRRYISSRVDNIISQLKAEQTIKEYDSYLLCSLIHGFMMHITLNIKSLAEFPGFKDDFTEIYNNFLQTLKKTP

Flanking regions ( +/- flanking 50bp)

TTCGCGAAACCATTTGATCATATGACAAGATGTGTATCCACCTTAACTTAATGATTTTTACCAAAATCATTAGGGGATTCATCAGGACGCGGCAGGCATTACTGATTTCGGCACACGGACTTTTTATTGAAAAAGGCTATCAGTCCGTTTCGATTGATGAAATTGCCCGTGATGCACGGGTCACAAAAGGGGCGTTTTATCACCACTTTAAAAGTAAAAGTGACCTGTTATTGCACTGCTATGAAATACAATTACAGAAAATCAGTGCTGTCCTCGATCATATTGAACCTCTGGCGGATAAATGGGAAGAGCTGCAGCTTGTTGTCCGCAGTTTTATGAATTATCTGGAACAGCATTACCGGGAACTGATTCCGGTTCAGGAAGTGATGCCGGTCGCCGGGTGGTATGAATTTGAGGATATTAACCGGCGCTATATCAGCAGCCGGGTGGATAATATTATCAGTCAGCTGAAAGCAGAGCAGACAATCAAAGAGTATGACTCTTATCTGTTATGCAGCCTGATCCACGGTTTTATGATGCATATTACCCTGAATATCAAAAGTCTCGCGGAATTCCCCGGCTTTAAAGATGATTTCACTGAAATTTATAATAACTTTCTGCAGACACTGAAAAAAACACCCTGACGGAATACATCCGCTGACATGACGTCAGCGGGCAGATAAAAAACGGGTAA