Homologs in group_1977

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_15635 EHELCC_15635 100.0 Morganella morganii S2 nfo deoxyribonuclease IV
NLDBIP_16165 NLDBIP_16165 100.0 Morganella morganii S4 nfo deoxyribonuclease IV
LHKJJB_15675 LHKJJB_15675 100.0 Morganella morganii S3 nfo deoxyribonuclease IV
HKOGLL_14795 HKOGLL_14795 100.0 Morganella morganii S5 nfo deoxyribonuclease IV
F4V73_RS07630 F4V73_RS07630 90.4 Morganella psychrotolerans nfo deoxyribonuclease IV
PMI_RS04115 PMI_RS04115 77.9 Proteus mirabilis HI4320 nfo deoxyribonuclease IV

Distribution of the homologs in the orthogroup group_1977

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1977

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8GGT5 4.47e-169 471 79 0 277 3 nfo Probable endonuclease 4 Serratia proteamaculans (strain 568)
B4ETA5 1.69e-166 465 78 0 277 3 nfo Probable endonuclease 4 Proteus mirabilis (strain HI4320)
Q7N364 2.15e-166 465 79 0 276 3 nfo Probable endonuclease 4 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DEL1 2.54e-165 462 78 0 277 3 nfo Probable endonuclease 4 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A7FK62 1.93e-164 460 78 0 277 3 nfo Probable endonuclease 4 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6D3L8 4.06e-164 459 78 0 277 3 nfo Probable endonuclease 4 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1JRM5 5.65e-164 459 78 0 277 3 nfo Probable endonuclease 4 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CR5 5.65e-164 459 78 0 277 3 nfo Probable endonuclease 4 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNA4 5.65e-164 459 78 0 277 3 nfo Probable endonuclease 4 Yersinia pestis (strain Pestoides F)
Q1CG79 5.65e-164 459 78 0 277 3 nfo Probable endonuclease 4 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4S1 5.65e-164 459 78 0 277 3 nfo Probable endonuclease 4 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGJ1 5.65e-164 459 78 0 277 3 nfo Probable endonuclease 4 Yersinia pestis
B2K9J1 5.65e-164 459 78 0 277 3 nfo Probable endonuclease 4 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C982 5.65e-164 459 78 0 277 3 nfo Probable endonuclease 4 Yersinia pestis bv. Antiqua (strain Antiqua)
Q31YW6 5.83e-163 456 77 0 277 3 nfo Probable endonuclease 4 Shigella boydii serotype 4 (strain Sb227)
B6I8L0 5.83e-163 456 77 0 277 3 nfo Probable endonuclease 4 Escherichia coli (strain SE11)
B1IYB0 5.83e-163 456 77 0 277 3 nfo Probable endonuclease 4 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A222 5.83e-163 456 77 0 277 3 nfo Probable endonuclease 4 Escherichia coli O9:H4 (strain HS)
B7M507 5.83e-163 456 77 0 277 3 nfo Probable endonuclease 4 Escherichia coli O8 (strain IAI1)
B7LAI2 5.83e-163 456 77 0 277 3 nfo Probable endonuclease 4 Escherichia coli (strain 55989 / EAEC)
A7ZNY3 5.83e-163 456 77 0 277 3 nfo Probable endonuclease 4 Escherichia coli O139:H28 (strain E24377A / ETEC)
A1JLX8 1.09e-162 455 78 0 277 3 nfo Probable endonuclease 4 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q83QW6 2.86e-162 454 76 0 277 3 nfo Probable endonuclease 4 Shigella flexneri
Q0T2W5 2.86e-162 454 76 0 277 3 nfo Probable endonuclease 4 Shigella flexneri serotype 5b (strain 8401)
Q32EQ7 2.95e-162 454 76 0 277 3 nfo Probable endonuclease 4 Shigella dysenteriae serotype 1 (strain Sd197)
P0A6C1 2.95e-162 454 76 0 277 1 nfo Endonuclease 4 Escherichia coli (strain K12)
B1X857 2.95e-162 454 76 0 277 3 nfo Probable endonuclease 4 Escherichia coli (strain K12 / DH10B)
C4ZU09 2.95e-162 454 76 0 277 3 nfo Probable endonuclease 4 Escherichia coli (strain K12 / MC4100 / BW2952)
B5YWV0 2.95e-162 454 76 0 277 3 nfo Probable endonuclease 4 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6C2 2.95e-162 454 76 0 277 3 nfo Probable endonuclease 4 Escherichia coli O157:H7
B7N5C2 3.48e-162 454 76 0 277 3 nfo Probable endonuclease 4 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FFU0 3.48e-162 454 76 0 277 3 nfo Probable endonuclease 4 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFT1 3.48e-162 454 76 0 277 3 nfo Probable endonuclease 4 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7NMX3 3.48e-162 454 76 0 277 3 nfo Probable endonuclease 4 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7UFH5 3.48e-162 454 76 0 277 3 nfo Probable endonuclease 4 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B2TVT4 5.39e-162 454 76 0 277 3 nfo Probable endonuclease 4 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7MX24 1.01e-161 453 76 0 277 3 nfo Probable endonuclease 4 Escherichia coli O81 (strain ED1a)
Q1R9R2 1.02e-161 453 76 0 277 3 nfo Probable endonuclease 4 Escherichia coli (strain UTI89 / UPEC)
A1AD18 1.02e-161 453 76 0 277 3 nfo Probable endonuclease 4 Escherichia coli O1:K1 / APEC
B7MF74 1.02e-161 453 76 0 277 3 nfo Probable endonuclease 4 Escherichia coli O45:K1 (strain S88 / ExPEC)
B1LKQ6 1.2e-161 453 76 0 277 3 nfo Probable endonuclease 4 Escherichia coli (strain SMS-3-5 / SECEC)
Q3Z047 1.27e-161 453 76 0 277 3 nfo Probable endonuclease 4 Shigella sonnei (strain Ss046)
B7LVB9 2.05e-161 452 76 0 277 3 nfo Probable endonuclease 4 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A8AE66 2.85e-160 449 75 0 277 3 nfo Probable endonuclease 4 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8Z593 7.56e-160 448 76 0 277 3 nfo Probable endonuclease 4 Salmonella typhi
B4TAM6 7.81e-160 448 76 0 277 3 nfo Probable endonuclease 4 Salmonella heidelberg (strain SL476)
B5BE34 8.25e-160 448 76 0 277 3 nfo Probable endonuclease 4 Salmonella paratyphi A (strain AKU_12601)
Q5PE50 8.25e-160 448 76 0 277 3 nfo Probable endonuclease 4 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A9MK49 1.08e-159 448 76 0 277 3 nfo Probable endonuclease 4 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B2VIH1 1.09e-159 448 75 0 280 3 nfo Probable endonuclease 4 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q8ZNK6 1.66e-159 447 76 0 277 3 nfo Probable endonuclease 4 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9N6I5 1.66e-159 447 76 0 277 3 nfo Probable endonuclease 4 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SY37 2.21e-159 447 76 0 277 3 nfo Probable endonuclease 4 Salmonella newport (strain SL254)
B5RC42 4.08e-159 446 75 0 277 3 nfo Probable endonuclease 4 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R173 4.08e-159 446 75 0 277 3 nfo Probable endonuclease 4 Salmonella enteritidis PT4 (strain P125109)
B5FNK8 4.08e-159 446 75 0 277 3 nfo Probable endonuclease 4 Salmonella dublin (strain CT_02021853)
B5EYQ5 4.08e-159 446 76 0 277 3 nfo Probable endonuclease 4 Salmonella agona (strain SL483)
B4TNR0 6.54e-159 446 76 0 277 3 nfo Probable endonuclease 4 Salmonella schwarzengrund (strain CVM19633)
C0Q0T7 2.38e-158 444 75 0 277 3 nfo Probable endonuclease 4 Salmonella paratyphi C (strain RKS4594)
Q57MD6 2.38e-158 444 75 0 277 3 nfo Probable endonuclease 4 Salmonella choleraesuis (strain SC-B67)
A7MLL2 6.04e-157 441 74 0 277 3 nfo Probable endonuclease 4 Cronobacter sakazakii (strain ATCC BAA-894)
A4WCJ5 1.33e-156 440 77 0 277 3 nfo Probable endonuclease 4 Enterobacter sp. (strain 638)
C5BCN2 1.46e-154 435 74 0 277 3 nfo Probable endonuclease 4 Edwardsiella ictaluri (strain 93-146)
A6TBP4 1.36e-153 432 75 0 277 3 nfo Probable endonuclease 4 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XP51 2.16e-153 432 75 0 277 3 nfo Probable endonuclease 4 Klebsiella pneumoniae (strain 342)
C4LD49 2.06e-144 409 70 0 278 3 nfo Probable endonuclease 4 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A7MS84 1.91e-141 402 67 0 277 3 nfo Probable endonuclease 4 Vibrio campbellii (strain ATCC BAA-1116)
B8F7D1 8.53e-141 400 65 0 280 3 nfo Probable endonuclease 4 Glaesserella parasuis serovar 5 (strain SH0165)
A4SMZ0 1.41e-140 399 66 0 280 3 nfo Probable endonuclease 4 Aeromonas salmonicida (strain A449)
Q87SC6 2.82e-140 399 67 0 277 3 nfo Probable endonuclease 4 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C3LQD2 1.1e-139 397 67 0 277 3 nfo Probable endonuclease 4 Vibrio cholerae serotype O1 (strain M66-2)
Q9KPK7 1.1e-139 397 67 0 277 3 nfo Probable endonuclease 4 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5R6 1.1e-139 397 67 0 277 3 nfo Probable endonuclease 4 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MNR1 9.84e-139 395 66 0 275 3 nfo Probable endonuclease 4 Vibrio vulnificus (strain YJ016)
Q8DEP6 1.09e-138 395 66 0 275 3 nfo Probable endonuclease 4 Vibrio vulnificus (strain CMCP6)
B0BTA9 7.23e-138 392 64 0 280 3 nfo Probable endonuclease 4 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H0M0 7.23e-138 392 64 0 280 3 nfo Probable endonuclease 4 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A0KK26 2.85e-137 391 65 0 280 3 nfo Probable endonuclease 4 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A3MZ76 4.55e-137 390 64 0 280 3 nfo Probable endonuclease 4 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q64WY5 5.37e-136 388 66 1 276 3 nfo Probable endonuclease 4 Bacteroides fragilis (strain YCH46)
Q5LG28 5.37e-136 388 66 1 276 3 nfo Probable endonuclease 4 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q6ASE4 1.12e-135 387 68 0 276 3 nfo Probable endonuclease 4 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q89YT0 1.5e-135 387 66 1 279 3 nfo Probable endonuclease 4 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
C0QMG1 9.37e-135 385 64 0 278 3 nfo Probable endonuclease 4 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q7M8B4 1.16e-133 382 65 0 279 3 nfo Probable endonuclease 4 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A6LB99 1.36e-133 382 64 0 275 3 nfo Probable endonuclease 4 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q7VMC4 2.59e-132 379 62 0 278 3 nfo Probable endonuclease 4 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B8D742 4.47e-132 378 61 0 280 3 nfo Probable endonuclease 4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57237 4.47e-132 378 61 0 280 3 nfo Probable endonuclease 4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8T8 4.47e-132 378 61 0 280 3 nfo Probable endonuclease 4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
P59058 2.16e-129 371 60 0 279 3 nfo Probable endonuclease 4 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q30PH2 7.37e-129 370 63 0 277 3 nfo Probable endonuclease 4 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A8EWW1 2.06e-128 369 64 0 280 3 nfo Probable endonuclease 4 Aliarcobacter butzleri (strain RM4018)
B3QQA9 4.95e-128 368 61 0 280 3 nfo Probable endonuclease 4 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B9L9K0 5.96e-128 367 62 0 279 3 nfo Probable endonuclease 4 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
B4S3I3 9.9e-128 367 62 0 279 3 nfo Probable endonuclease 4 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A8ZSE7 1.09e-127 367 63 0 280 3 nfo Probable endonuclease 4 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
A0L901 2.83e-125 361 60 0 280 3 nfo Probable endonuclease 4 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q3AT74 5.69e-125 360 61 0 280 3 nfo Probable endonuclease 4 Chlorobium chlorochromatii (strain CaD3)
A6Q1P1 9.5e-125 359 62 0 277 3 nfo Probable endonuclease 4 Nitratiruptor sp. (strain SB155-2)
A6QCI0 1.19e-122 355 60 2 295 3 nfo Probable endonuclease 4 Sulfurovum sp. (strain NBC37-1)
Q8KFL0 7.03e-122 352 61 0 275 3 nfo Probable endonuclease 4 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B3ELV8 7.84e-121 350 59 0 280 3 nfo Probable endonuclease 4 Chlorobium phaeobacteroides (strain BS1)
Q6LUP5 4.19e-120 347 62 0 256 3 nfo Probable endonuclease 4 Photobacterium profundum (strain SS9)
A7GW36 1.04e-119 347 58 0 280 3 nfo Probable endonuclease 4 Campylobacter curvus (strain 525.92)
A8Z6D9 6.42e-119 345 58 0 280 3 nfo Probable endonuclease 4 Campylobacter concisus (strain 13826)
B4SE58 2.79e-118 343 58 0 280 3 nfo Probable endonuclease 4 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A6L330 6.05e-118 342 59 1 279 3 nfo Probable endonuclease 4 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q3B5R5 2.9e-117 340 58 0 279 3 nfo Probable endonuclease 4 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A0RRG4 7.96e-117 339 57 0 280 3 nfo Probable endonuclease 4 Campylobacter fetus subsp. fetus (strain 82-40)
B3EEJ7 1.08e-114 334 58 0 278 3 nfo Probable endonuclease 4 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A4SDE2 1.83e-114 333 57 0 279 3 nfo Probable endonuclease 4 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A7I010 6.21e-113 330 58 0 280 3 nfo Probable endonuclease 4 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
P59496 9.57e-113 329 54 0 278 3 nfo Probable endonuclease 4 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q10002 1.81e-95 289 50 0 261 2 apn-1 Apurinic-apyrimidinic endonuclease Caenorhabditis elegans
A0A509ASK2 3.6e-90 279 48 1 277 2 APN1 Apurinic-apyrimidinic endonuclease 1 Plasmodium berghei (strain Anka)
Q966U0 7.58e-88 274 46 1 275 1 apnA Endonuclease 4 homolog Dictyostelium discoideum
Q8IE02 6.12e-87 273 47 1 272 1 APN1 Apurinic-apyrimidinic endonuclease 1 Plasmodium falciparum (isolate 3D7)
Q6MED0 2.45e-82 252 47 4 275 3 nfo Probable endonuclease 4 Protochlamydia amoebophila (strain UWE25)
Q824X6 1.28e-77 240 41 4 284 3 nfo Probable endonuclease 4 Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
B8G418 2.13e-77 239 43 4 285 3 nfo Probable endonuclease 4 Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q5L798 1.85e-74 232 41 4 281 3 nfo Probable endonuclease 4 Chlamydia abortus (strain DSM 27085 / S26/3)
P22936 1.93e-74 234 43 3 278 1 APN1 Apurinic-apyrimidinic endonuclease 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B9LAM9 6.34e-74 230 42 4 283 3 nfo Probable endonuclease 4 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WII8 6.34e-74 230 42 4 283 3 nfo Probable endonuclease 4 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A1WXM0 3.07e-70 221 44 5 281 3 nfo Probable endonuclease 4 Halorhodospira halophila (strain DSM 244 / SL1)
Q74FS7 1.09e-69 220 43 4 267 3 nfo Probable endonuclease 4 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A9B5N7 1.44e-69 219 43 5 285 3 nfo Probable endonuclease 4 Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q9Z7H3 2.13e-69 219 39 4 284 3 nfo Probable endonuclease 4 Chlamydia pneumoniae
Q9PJB8 2.31e-67 214 39 4 279 3 nfo Probable endonuclease 4 Chlamydia muridarum (strain MoPn / Nigg)
B3E325 1.51e-66 211 40 4 281 3 nfo Probable endonuclease 4 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
P50525 1.02e-64 209 41 3 256 5 apn1 Apurinic-apyrimidinic endonuclease 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B5EAS8 4.94e-64 205 39 3 280 3 nfo Probable endonuclease 4 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
O84630 1.69e-63 204 38 4 279 3 nfo Probable endonuclease 4 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KL70 1.69e-63 204 38 4 279 3 nfo Probable endonuclease 4 Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B9M4N1 2.52e-63 203 41 4 267 3 nfo Probable endonuclease 4 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B0BA79 5.81e-63 202 38 4 279 3 nfo Probable endonuclease 4 Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B8K0 5.81e-63 202 38 4 279 3 nfo Probable endonuclease 4 Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
A6LMU8 3.51e-62 200 38 1 262 3 nfo Probable endonuclease 4 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
C6DYE3 8.17e-62 199 39 5 287 3 nfo Probable endonuclease 4 Geobacter sp. (strain M21)
Q30YP7 7.47e-61 197 41 3 262 3 nfo Probable endonuclease 4 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A9A555 1.88e-59 193 40 1 259 3 nfo Probable endonuclease 4 Nitrosopumilus maritimus (strain SCM1)
B7IDS7 2.49e-59 193 38 1 262 3 nfo Probable endonuclease 4 Thermosipho africanus (strain TCF52B)
Q9HJS3 1.69e-57 188 40 7 262 3 nfo Probable endonuclease 4 Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
B1L9C6 4.23e-57 187 37 1 262 3 nfo Probable endonuclease 4 Thermotoga sp. (strain RQ2)
Q9WYJ7 5.9e-57 187 36 1 262 1 nfo Probable endonuclease 4 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A0RYW7 6.6e-57 187 39 1 259 3 nfo Probable endonuclease 4 Cenarchaeum symbiosum (strain A)
A3CT71 7e-57 187 38 3 264 3 nfo Probable endonuclease 4 Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q72CQ9 8.59e-57 186 39 3 282 3 nfo Probable endonuclease 4 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A5IK54 2.43e-56 186 35 1 262 3 nfo Probable endonuclease 4 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
B8CW79 2.45e-56 185 40 3 260 3 nfo Probable endonuclease 4 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B9KBS2 2.59e-56 185 36 1 262 3 nfo Probable endonuclease 4 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
A1VEI5 1.76e-55 183 38 3 282 3 nfo Probable endonuclease 4 Nitratidesulfovibrio vulgaris (strain DP4)
A9BJ15 1.61e-54 181 34 3 283 3 nfo Probable endonuclease 4 Petrotoga mobilis (strain DSM 10674 / SJ95)
B8GKX5 1.2e-53 179 38 4 267 3 nfo Probable endonuclease 4 Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
O67551 6.65e-50 169 35 4 264 3 nfo Probable endonuclease 4 Aquifex aeolicus (strain VF5)
Q97A09 5.29e-49 166 37 6 260 3 nfo Probable endonuclease 4 Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
B2UQE3 5.31e-49 166 33 4 277 3 nfo Probable endonuclease 4 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
B0TD39 5.81e-49 166 35 5 280 3 nfo Probable endonuclease 4 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q189A4 5.67e-48 164 34 3 262 3 nfo Probable endonuclease 4 Clostridioides difficile (strain 630)
B3DS13 6.51e-47 161 34 6 282 3 nfo Probable endonuclease 4 Bifidobacterium longum (strain DJO10A)
Q3IMK8 4.96e-46 159 37 4 262 3 nfo Probable endonuclease 4 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q8G689 1.25e-45 158 32 5 282 3 nfo Probable endonuclease 4 Bifidobacterium longum (strain NCC 2705)
B2TL64 3.08e-45 156 34 4 281 3 nfo Probable endonuclease 4 Clostridium botulinum (strain Eklund 17B / Type B)
B2V158 1.32e-44 155 33 4 281 3 nfo Probable endonuclease 4 Clostridium botulinum (strain Alaska E43 / Type E3)
Q2NFM3 2.58e-44 154 32 5 282 3 nfo Probable endonuclease 4 Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q8EWT2 4.68e-44 154 33 8 286 3 nfo Probable endonuclease 4 Malacoplasma penetrans (strain HF-2)
Q3ABA7 5.71e-44 153 35 5 278 3 nfo Probable endonuclease 4 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q67S99 8.12e-44 153 36 5 278 3 nfo Probable endonuclease 4 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q18KA6 2.92e-43 151 34 5 274 3 nfo Probable endonuclease 4 Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q7NBA9 4.51e-43 152 35 5 248 3 nfo Probable endonuclease 4 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q5V0S8 1.06e-42 150 35 4 274 3 nfo Probable endonuclease 4 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
B7GRN1 2.6e-42 149 32 6 282 3 nfo Probable endonuclease 4 Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
A6LQV9 2.99e-42 149 32 4 279 3 nfo Probable endonuclease 4 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q9HSK7 3.91e-42 148 35 5 271 3 nfo Probable endonuclease 4 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R2U6 3.91e-42 148 35 5 271 3 nfo Probable endonuclease 4 Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q5WHC2 5.03e-42 149 33 5 262 3 nfo Probable endonuclease 4 Shouchella clausii (strain KSM-K16)
Q9KD33 7.2e-41 146 33 6 266 3 nfo Probable endonuclease 4 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A9NFH1 1.15e-40 145 33 4 266 3 nfo Probable endonuclease 4 Acholeplasma laidlawii (strain PG-8A)
A8ML82 3.35e-40 144 31 4 277 3 nfo Probable endonuclease 4 Alkaliphilus oremlandii (strain OhILAs)
Q72KH8 8.03e-40 142 36 10 283 1 nfo Endonuclease 4 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
C5D4R0 1.92e-39 142 33 9 292 3 nfo Probable endonuclease 4 Geobacillus sp. (strain WCH70)
C0QRI1 2.33e-39 141 30 4 270 3 nfo Probable endonuclease 4 Persephonella marina (strain DSM 14350 / EX-H1)
A2SPZ6 6.06e-39 140 33 4 269 3 nfo Probable endonuclease 4 Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
B7GH81 8.61e-39 140 33 6 266 3 nfo Probable endonuclease 4 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q6GGE2 9.1e-39 140 31 6 264 1 nfo Probable endonuclease 4 Staphylococcus aureus (strain MRSA252)
Q49Y00 1.01e-38 140 31 6 263 3 nfo Probable endonuclease 4 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A8Z497 1.02e-38 140 31 6 264 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain USA300 / TCH1516)
A6QHA0 1.02e-38 140 31 6 264 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain Newman)
Q5HFK3 1.02e-38 140 31 6 264 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain COL)
Q2YT22 1.02e-38 140 31 6 264 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FY16 1.02e-38 140 31 6 264 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FGG6 1.02e-38 140 31 6 264 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain USA300)
P63539 7.92e-38 138 31 6 264 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain MW2)
Q6G909 7.92e-38 138 31 6 264 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain MSSA476)
P63538 7.92e-38 138 31 6 264 1 nfo Probable endonuclease 4 Staphylococcus aureus (strain N315)
P63537 7.92e-38 138 31 6 264 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IT85 7.92e-38 138 31 6 264 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain JH9)
A6U229 7.92e-38 138 31 6 264 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain JH1)
A7X2V2 7.92e-38 138 31 6 264 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain Mu3 / ATCC 700698)
B2V7A4 1.31e-37 137 33 7 286 3 nfo Probable endonuclease 4 Sulfurihydrogenibium sp. (strain YO3AOP1)
Q8EPZ2 1.48e-37 137 32 6 268 3 nfo Probable endonuclease 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B9DNM8 1.51e-37 137 30 5 262 3 nfo Probable endonuclease 4 Staphylococcus carnosus (strain TM300)
Q9PQI5 2.92e-37 136 32 4 262 3 nfo Probable endonuclease 4 Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q5KX27 4.77e-37 136 32 7 288 1 nfo Probable endonuclease 4 Geobacillus kaustophilus (strain HTA426)
Q65HA0 4.8e-37 136 32 5 265 3 nfo Probable endonuclease 4 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A4IR02 5.25e-37 135 33 10 293 3 nfo Probable endonuclease 4 Geobacillus thermodenitrificans (strain NG80-2)
Q2RJF1 6.25e-37 135 31 5 280 3 nfo Probable endonuclease 4 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q01TU5 6.37e-37 135 32 7 267 3 nfo Probable endonuclease 4 Solibacter usitatus (strain Ellin6076)
Q82AG6 1.71e-36 135 32 4 266 3 nfo Probable endonuclease 4 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9S2N2 4.55e-36 133 32 4 281 3 nfo Probable endonuclease 4 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q4L6Q7 4.66e-36 133 30 7 265 3 nfo Probable endonuclease 4 Staphylococcus haemolyticus (strain JCSC1435)
Q03F56 5.64e-36 133 30 8 289 3 nfo Probable endonuclease 4 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
P54476 1.4e-35 132 30 5 265 3 nfo Probable endonuclease 4 Bacillus subtilis (strain 168)
Q8CP25 1.94e-35 132 29 5 262 3 nfo Probable endonuclease 4 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNZ1 1.94e-35 132 29 5 262 3 nfo Probable endonuclease 4 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A7GSY1 1.84e-34 129 30 7 268 3 nfo Probable endonuclease 4 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B1YL88 1.86e-34 129 33 11 293 3 nfo Probable endonuclease 4 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q834D0 2.27e-34 129 30 5 262 3 nfo Probable endonuclease 4 Enterococcus faecalis (strain ATCC 700802 / V583)
A7Z6S8 3.53e-34 128 31 5 265 3 nfo Probable endonuclease 4 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q2NJF9 4.87e-34 128 35 7 219 3 nfo Probable endonuclease 4 Aster yellows witches'-broom phytoplasma (strain AYWB)
B5ZBB4 9.27e-34 127 29 6 278 3 nfo Probable endonuclease 4 Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
Q92BR0 1.73e-33 126 31 5 265 3 nfo Probable endonuclease 4 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q6YQC1 3.11e-33 125 33 5 216 3 nfo Probable endonuclease 4 Onion yellows phytoplasma (strain OY-M)
B0S196 7.87e-33 124 29 7 278 3 nfo Probable endonuclease 4 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q8Y756 9.52e-33 124 31 7 292 3 nfo Probable endonuclease 4 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q38XB2 1.2e-32 124 30 6 287 3 nfo Probable endonuclease 4 Latilactobacillus sakei subsp. sakei (strain 23K)
Q81LV1 1.27e-32 124 29 7 268 1 nfo Probable endonuclease 4 Bacillus anthracis
C3LKW3 1.27e-32 124 29 7 268 3 nfo Probable endonuclease 4 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P8J1 1.27e-32 124 29 7 268 3 nfo Probable endonuclease 4 Bacillus anthracis (strain A0248)
Q4A8V0 1.48e-32 124 35 6 214 3 nfo Probable endonuclease 4 Mesomycoplasma hyopneumoniae (strain 7448)
A0AIQ1 1.51e-32 124 30 7 290 3 nfo Probable endonuclease 4 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A9VHR4 1.59e-32 124 30 7 268 3 nfo Probable endonuclease 4 Bacillus mycoides (strain KBAB4)
B7JN09 1.66e-32 124 29 7 268 3 nfo Probable endonuclease 4 Bacillus cereus (strain AH820)
Q6HDN3 1.97e-32 124 29 7 268 3 nfo Probable endonuclease 4 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q634Q3 1.97e-32 124 29 7 268 3 nfo Probable endonuclease 4 Bacillus cereus (strain ZK / E33L)
C1ES07 1.97e-32 124 29 7 268 3 nfo Probable endonuclease 4 Bacillus cereus (strain 03BB102)
A0RIQ8 1.97e-32 124 29 7 268 3 nfo Probable endonuclease 4 Bacillus thuringiensis (strain Al Hakam)
C1KV96 2.35e-32 124 30 5 265 3 nfo Probable endonuclease 4 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q71ZM1 2.37e-32 124 30 5 265 3 nfo Probable endonuclease 4 Listeria monocytogenes serotype 4b (strain F2365)
Q4AAX4 3.29e-32 122 35 6 214 3 nfo Probable endonuclease 4 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q601Y6 3.98e-32 122 35 6 214 3 nfo Probable endonuclease 4 Mesomycoplasma hyopneumoniae (strain 232)
B9IY53 5.8e-32 122 29 7 268 3 nfo Probable endonuclease 4 Bacillus cereus (strain Q1)
B7HPI4 5.8e-32 122 29 7 268 3 nfo Probable endonuclease 4 Bacillus cereus (strain AH187)
Q4A6S5 6.2e-32 122 32 5 213 3 nfo Probable endonuclease 4 Mycoplasmopsis synoviae (strain 53)
B1HTF6 7.3e-32 122 29 5 262 3 nfo Probable endonuclease 4 Lysinibacillus sphaericus (strain C3-41)
B7IYD6 1.1e-31 122 29 7 268 3 nfo Probable endonuclease 4 Bacillus cereus (strain G9842)
Q818H3 1.2e-31 122 29 7 268 3 nfo Probable endonuclease 4 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HCQ9 1.2e-31 122 29 7 268 3 nfo Probable endonuclease 4 Bacillus cereus (strain B4264)
P47477 2.54e-31 120 28 6 286 3 nfo Probable endonuclease 4 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q6F1D3 3.56e-30 117 30 3 215 3 nfo Probable endonuclease 4 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q88VR2 1.38e-29 116 28 6 266 3 nfo Probable endonuclease 4 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A5IYT8 3e-29 115 33 6 214 3 nfo Probable endonuclease 4 Mycoplasmopsis agalactiae (strain NCTC 10123 / CIP 59.7 / PG2)
B2A499 3.34e-29 115 29 4 264 3 nfo Probable endonuclease 4 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q6MUC7 5.79e-29 114 29 6 271 3 nfo Probable endonuclease 4 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q6KH96 3.43e-28 112 28 5 214 3 nfo Probable endonuclease 4 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
P75457 4.87e-28 112 29 3 217 3 nfo Probable endonuclease 4 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
B3PMH1 1.24e-27 110 30 3 213 3 nfo Probable endonuclease 4 Metamycoplasma arthritidis (strain 158L3-1)
Q2ST57 9.7e-27 108 27 6 271 3 nfo Probable endonuclease 4 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
A9KNS9 1.28e-26 108 27 5 265 3 nfo Probable endonuclease 4 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q5UPY4 2.47e-25 105 29 10 285 3 MIMI_R296 Putative endonuclease 4 Acanthamoeba polyphaga mimivirus
Q98PU8 3.56e-25 104 35 10 224 3 nfo Probable endonuclease 4 Mycoplasmopsis pulmonis (strain UAB CTIP)
P9WQ13 5.06e-16 79 29 11 262 1 end Probable endonuclease 4 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ12 5.06e-16 79 29 11 262 3 end Probable endonuclease 4 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U056 5.06e-16 79 29 11 262 3 nfo Probable endonuclease 4 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AL03 5.06e-16 79 29 11 262 3 nfo Probable endonuclease 4 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KGF0 5.06e-16 79 29 11 262 3 nfo Probable endonuclease 4 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P63536 5.06e-16 79 29 11 262 3 nfo Probable endonuclease 4 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P30770 1.32e-13 72 28 9 260 3 nfo Probable endonuclease 4 Mycobacterium leprae (strain TN)
B8ZSC5 1.32e-13 72 28 9 260 3 nfo Probable endonuclease 4 Mycobacterium leprae (strain Br4923)
O86954 1.49e-13 68 39 0 82 3 nfo Probable endonuclease 4 (Fragment) Thermotoga neapolitana
P42691 2.03e-12 63 80 0 31 3 nfo Probable endonuclease 4 (Fragment) Yersinia enterocolitica
A0PM27 2.05e-12 68 29 11 261 3 nfo Probable endonuclease 4 Mycobacterium ulcerans (strain Agy99)
B2HSJ8 2.42e-12 68 29 11 261 3 nfo Probable endonuclease 4 Mycobacterium marinum (strain ATCC BAA-535 / M)
Q65246 1.38e-06 52 26 8 163 3 Mal-142 Probable AP endonuclease African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983)
P0C9C7 2.15e-05 48 26 8 163 3 War-144 Probable AP endonuclease African swine fever virus (isolate Warthog/Namibia/Wart80/1980)
Q65202 2.15e-05 48 26 8 163 1 Ba71V-134 Probable AP endonuclease African swine fever virus (strain Badajoz 1971 Vero-adapted)
P0C9C6 2.23e-05 48 26 8 163 1 Pret-146 Probable AP endonuclease African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_14830
Feature type CDS
Gene nfo
Product deoxyribonuclease IV
Location 67819 - 68661 (strand: 1)
Length 843 (nucleotides) / 280 (amino acids)

Contig

Accession contig_19
Length 86773 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1977
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01261 Xylose isomerase-like TIM barrel

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0648 Replication, recombination and repair (L) L Endonuclease IV

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01151 deoxyribonuclease IV [EC:3.1.21.2] Base excision repair -

Protein Sequence

MKYVGAHVSAAGGVDQAVIRAHELGATAFALFTKNQRQWKAAPLPENVIAAFKANCKKYGYGHGQILPHDSYLINLGHPETEALEKSREAFLDELQRCEQLGIDRLNFHPGSHLNKIEENDCLARIAESINIALDKTSGVIAVIENTAGQGSNLGFRFEQLAAIIDDVEDKSRIGVCIDTCHAFAAGYDLRTPETCKATFADFESIVGFEYLKGMHLNDAKSEFASRVDRHDSLGQGKIGNAPFEFIMKDKRFDGIPMVLETVNPDIWAQEIAWLKSLEK

Flanking regions ( +/- flanking 50bp)

CATTCTCCGGTTCCTTATGCCATAATCGGCACAAAGAAGGAGAAAAACCAATGAAATATGTCGGAGCACACGTCAGCGCCGCCGGTGGTGTTGATCAGGCAGTTATCCGTGCGCATGAACTGGGCGCCACAGCCTTTGCCCTGTTCACCAAAAATCAGCGCCAGTGGAAAGCTGCCCCCCTGCCGGAAAACGTCATCGCGGCCTTTAAGGCCAACTGCAAAAAATACGGCTACGGCCACGGGCAGATCCTGCCCCACGACAGCTATCTGATTAACCTCGGCCATCCGGAAACGGAAGCACTGGAAAAATCCCGCGAGGCATTTCTTGATGAATTGCAGCGCTGCGAACAGCTCGGGATCGACCGTCTGAATTTCCATCCCGGCAGCCACCTCAATAAGATTGAGGAAAATGATTGTCTGGCGCGGATCGCGGAATCCATTAATATTGCGCTGGATAAAACCAGCGGTGTGATTGCCGTGATTGAAAATACCGCCGGACAGGGCAGCAACCTCGGGTTCCGCTTTGAGCAGCTGGCCGCCATTATTGACGATGTGGAGGATAAATCCCGCATTGGTGTCTGTATCGATACCTGCCACGCGTTTGCCGCCGGGTATGATCTGCGGACACCGGAAACCTGCAAAGCCACGTTTGCGGATTTTGAAAGCATTGTCGGGTTTGAGTATCTGAAGGGCATGCACCTGAATGATGCAAAAAGTGAATTCGCCAGCCGTGTTGACCGTCACGATAGTCTCGGTCAGGGTAAAATCGGCAATGCGCCGTTTGAGTTTATTATGAAAGATAAACGGTTCGACGGCATCCCGATGGTACTGGAAACCGTGAATCCGGATATCTGGGCGCAGGAAATTGCCTGGCTGAAATCGCTGGAAAAATAACCCGGGTTATACCACCGGGCTGAGTTTGATTTTTGCCATCATTGCTGCCA