Homologs in group_1977

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14830 FBDBKF_14830 90.4 Morganella morganii S1 nfo deoxyribonuclease IV
EHELCC_15635 EHELCC_15635 90.4 Morganella morganii S2 nfo deoxyribonuclease IV
NLDBIP_16165 NLDBIP_16165 90.4 Morganella morganii S4 nfo deoxyribonuclease IV
LHKJJB_15675 LHKJJB_15675 90.4 Morganella morganii S3 nfo deoxyribonuclease IV
HKOGLL_14795 HKOGLL_14795 90.4 Morganella morganii S5 nfo deoxyribonuclease IV
PMI_RS04115 PMI_RS04115 78.6 Proteus mirabilis HI4320 nfo deoxyribonuclease IV

Distribution of the homologs in the orthogroup group_1977

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1977

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4ETA5 2.81e-168 469 79 0 277 3 nfo Probable endonuclease 4 Proteus mirabilis (strain HI4320)
Q7N364 1.86e-165 462 78 0 276 3 nfo Probable endonuclease 4 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GGT5 5.71e-161 451 76 0 277 3 nfo Probable endonuclease 4 Serratia proteamaculans (strain 568)
C6DEL1 2.39e-160 449 76 0 277 3 nfo Probable endonuclease 4 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D3L8 1.12e-158 445 75 0 277 3 nfo Probable endonuclease 4 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2VIH1 1.55e-158 445 74 0 280 3 nfo Probable endonuclease 4 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B7LVB9 1.26e-156 440 74 0 277 3 nfo Probable endonuclease 4 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LKQ6 1.44e-156 440 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli (strain SMS-3-5 / SECEC)
A8AE66 3.23e-156 439 73 0 277 3 nfo Probable endonuclease 4 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q31YW6 3.64e-156 439 73 0 277 3 nfo Probable endonuclease 4 Shigella boydii serotype 4 (strain Sb227)
B6I8L0 3.64e-156 439 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli (strain SE11)
B1IYB0 3.64e-156 439 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A222 3.64e-156 439 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli O9:H4 (strain HS)
B7M507 3.64e-156 439 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli O8 (strain IAI1)
B7LAI2 3.64e-156 439 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli (strain 55989 / EAEC)
A7ZNY3 3.64e-156 439 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli O139:H28 (strain E24377A / ETEC)
B7N5C2 3.81e-156 439 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FFU0 3.81e-156 439 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFT1 3.81e-156 439 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7NMX3 3.81e-156 439 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7UFH5 3.81e-156 439 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5RC42 4.49e-156 439 74 0 277 3 nfo Probable endonuclease 4 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R173 4.49e-156 439 74 0 277 3 nfo Probable endonuclease 4 Salmonella enteritidis PT4 (strain P125109)
B5FNK8 4.49e-156 439 74 0 277 3 nfo Probable endonuclease 4 Salmonella dublin (strain CT_02021853)
Q8Z593 4.54e-156 439 74 0 277 3 nfo Probable endonuclease 4 Salmonella typhi
B4TAM6 6.1e-156 439 74 0 277 3 nfo Probable endonuclease 4 Salmonella heidelberg (strain SL476)
Q32EQ7 6.88e-156 438 73 0 277 3 nfo Probable endonuclease 4 Shigella dysenteriae serotype 1 (strain Sd197)
P0A6C1 6.88e-156 438 73 0 277 1 nfo Endonuclease 4 Escherichia coli (strain K12)
B1X857 6.88e-156 438 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli (strain K12 / DH10B)
C4ZU09 6.88e-156 438 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli (strain K12 / MC4100 / BW2952)
B5YWV0 6.88e-156 438 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6C2 6.88e-156 438 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli O157:H7
Q1R9R2 8.56e-156 438 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli (strain UTI89 / UPEC)
A1AD18 8.56e-156 438 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli O1:K1 / APEC
B7MF74 8.56e-156 438 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli O45:K1 (strain S88 / ExPEC)
B5BE34 9.14e-156 438 74 0 277 3 nfo Probable endonuclease 4 Salmonella paratyphi A (strain AKU_12601)
Q5PE50 9.14e-156 438 74 0 277 3 nfo Probable endonuclease 4 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZNK6 9.55e-156 438 74 0 277 3 nfo Probable endonuclease 4 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9N6I5 9.55e-156 438 74 0 277 3 nfo Probable endonuclease 4 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B7MX24 1.08e-155 438 73 0 277 3 nfo Probable endonuclease 4 Escherichia coli O81 (strain ED1a)
Q83QW6 1.71e-155 437 73 0 277 3 nfo Probable endonuclease 4 Shigella flexneri
Q0T2W5 1.71e-155 437 73 0 277 3 nfo Probable endonuclease 4 Shigella flexneri serotype 5b (strain 8401)
A9MK49 1.8e-155 437 74 0 277 3 nfo Probable endonuclease 4 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B4SY37 1.95e-155 437 74 0 277 3 nfo Probable endonuclease 4 Salmonella newport (strain SL254)
B2TVT4 4.53e-155 436 73 0 277 3 nfo Probable endonuclease 4 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q3Z047 9.03e-155 436 73 0 277 3 nfo Probable endonuclease 4 Shigella sonnei (strain Ss046)
A7FK62 9.54e-155 436 74 0 277 3 nfo Probable endonuclease 4 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B5EYQ5 1.74e-154 435 74 0 277 3 nfo Probable endonuclease 4 Salmonella agona (strain SL483)
B1JRM5 2.32e-154 434 74 0 277 3 nfo Probable endonuclease 4 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CR5 2.32e-154 434 74 0 277 3 nfo Probable endonuclease 4 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNA4 2.32e-154 434 74 0 277 3 nfo Probable endonuclease 4 Yersinia pestis (strain Pestoides F)
Q1CG79 2.32e-154 434 74 0 277 3 nfo Probable endonuclease 4 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4S1 2.32e-154 434 74 0 277 3 nfo Probable endonuclease 4 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGJ1 2.32e-154 434 74 0 277 3 nfo Probable endonuclease 4 Yersinia pestis
B2K9J1 2.32e-154 434 74 0 277 3 nfo Probable endonuclease 4 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C982 2.32e-154 434 74 0 277 3 nfo Probable endonuclease 4 Yersinia pestis bv. Antiqua (strain Antiqua)
C0Q0T7 2.85e-154 434 74 0 277 3 nfo Probable endonuclease 4 Salmonella paratyphi C (strain RKS4594)
Q57MD6 2.85e-154 434 74 0 277 3 nfo Probable endonuclease 4 Salmonella choleraesuis (strain SC-B67)
A4WCJ5 3.18e-154 434 76 0 277 3 nfo Probable endonuclease 4 Enterobacter sp. (strain 638)
A1JLX8 8.62e-154 433 74 0 277 3 nfo Probable endonuclease 4 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B4TNR0 1.52e-153 432 73 0 277 3 nfo Probable endonuclease 4 Salmonella schwarzengrund (strain CVM19633)
A7MLL2 2.05e-153 432 73 0 277 3 nfo Probable endonuclease 4 Cronobacter sakazakii (strain ATCC BAA-894)
B5XP51 1.4e-151 427 74 0 277 3 nfo Probable endonuclease 4 Klebsiella pneumoniae (strain 342)
A6TBP4 5.28e-151 426 73 0 277 3 nfo Probable endonuclease 4 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
C5BCN2 1.4e-147 417 71 0 277 3 nfo Probable endonuclease 4 Edwardsiella ictaluri (strain 93-146)
C4LD49 1.17e-144 410 70 0 278 3 nfo Probable endonuclease 4 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A7MS84 3.59e-140 399 67 0 277 3 nfo Probable endonuclease 4 Vibrio campbellii (strain ATCC BAA-1116)
C3LQD2 2.01e-138 394 67 0 275 3 nfo Probable endonuclease 4 Vibrio cholerae serotype O1 (strain M66-2)
Q9KPK7 2.01e-138 394 67 0 275 3 nfo Probable endonuclease 4 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5R6 2.01e-138 394 67 0 275 3 nfo Probable endonuclease 4 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87SC6 3.22e-138 394 67 0 277 3 nfo Probable endonuclease 4 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A0KK26 1.24e-137 392 66 0 280 3 nfo Probable endonuclease 4 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SMZ0 4.27e-137 390 66 0 280 3 nfo Probable endonuclease 4 Aeromonas salmonicida (strain A449)
Q64WY5 1.86e-136 389 67 1 276 3 nfo Probable endonuclease 4 Bacteroides fragilis (strain YCH46)
Q5LG28 1.86e-136 389 67 1 276 3 nfo Probable endonuclease 4 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q7MNR1 3.29e-136 389 66 0 275 3 nfo Probable endonuclease 4 Vibrio vulnificus (strain YJ016)
Q8DEP6 5.94e-136 388 66 0 275 3 nfo Probable endonuclease 4 Vibrio vulnificus (strain CMCP6)
Q6ASE4 2.32e-134 384 67 0 276 3 nfo Probable endonuclease 4 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q89YT0 4.37e-134 383 64 1 279 3 nfo Probable endonuclease 4 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
C0QMG1 1.02e-133 382 64 0 278 3 nfo Probable endonuclease 4 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B8F7D1 1.05e-133 382 62 0 280 3 nfo Probable endonuclease 4 Glaesserella parasuis serovar 5 (strain SH0165)
B0BTA9 1.43e-133 382 63 0 280 3 nfo Probable endonuclease 4 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H0M0 1.43e-133 382 63 0 280 3 nfo Probable endonuclease 4 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MZ76 7.17e-133 380 63 0 280 3 nfo Probable endonuclease 4 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6LB99 1.41e-131 377 64 0 275 3 nfo Probable endonuclease 4 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q7M8B4 3.2e-130 373 64 0 279 3 nfo Probable endonuclease 4 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B8D742 4.29e-130 373 61 0 280 3 nfo Probable endonuclease 4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57237 4.29e-130 373 61 0 280 3 nfo Probable endonuclease 4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8T8 4.29e-130 373 61 0 280 3 nfo Probable endonuclease 4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B4S3I3 7.62e-128 367 61 0 279 3 nfo Probable endonuclease 4 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
P59058 9.2e-128 367 59 0 279 3 nfo Probable endonuclease 4 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A8EWW1 1.33e-126 364 62 0 280 3 nfo Probable endonuclease 4 Aliarcobacter butzleri (strain RM4018)
A8ZSE7 1.53e-126 364 65 0 280 3 nfo Probable endonuclease 4 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q30PH2 5.71e-126 362 62 0 277 3 nfo Probable endonuclease 4 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q7VMC4 9.76e-126 362 60 0 278 3 nfo Probable endonuclease 4 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B9L9K0 2.5e-125 361 60 0 279 3 nfo Probable endonuclease 4 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
A0L901 3.68e-125 360 60 0 280 3 nfo Probable endonuclease 4 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A6QCI0 2.76e-124 359 60 2 295 3 nfo Probable endonuclease 4 Sulfurovum sp. (strain NBC37-1)
Q3AT74 7.95e-124 357 61 0 280 3 nfo Probable endonuclease 4 Chlorobium chlorochromatii (strain CaD3)
A6Q1P1 2.02e-122 353 61 0 277 3 nfo Probable endonuclease 4 Nitratiruptor sp. (strain SB155-2)
B3QQA9 3.1e-122 353 60 0 280 3 nfo Probable endonuclease 4 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B3ELV8 5.06e-121 350 59 0 280 3 nfo Probable endonuclease 4 Chlorobium phaeobacteroides (strain BS1)
Q8KFL0 4.04e-119 345 61 0 275 3 nfo Probable endonuclease 4 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q3B5R5 1.08e-118 344 59 0 279 3 nfo Probable endonuclease 4 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A6L330 9.9e-118 342 59 1 279 3 nfo Probable endonuclease 4 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
B4SE58 3.17e-117 340 58 0 280 3 nfo Probable endonuclease 4 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A7GW36 8.6e-117 339 58 0 280 3 nfo Probable endonuclease 4 Campylobacter curvus (strain 525.92)
B3EEJ7 2.25e-116 338 59 0 278 3 nfo Probable endonuclease 4 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q6LUP5 1.37e-115 336 61 0 252 3 nfo Probable endonuclease 4 Photobacterium profundum (strain SS9)
A8Z6D9 1.54e-115 336 58 0 280 3 nfo Probable endonuclease 4 Campylobacter concisus (strain 13826)
A4SDE2 2.49e-114 333 57 0 279 3 nfo Probable endonuclease 4 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A0RRG4 6.37e-112 327 55 0 280 3 nfo Probable endonuclease 4 Campylobacter fetus subsp. fetus (strain 82-40)
A7I010 4.23e-110 322 57 0 280 3 nfo Probable endonuclease 4 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
P59496 2.02e-106 313 51 0 278 3 nfo Probable endonuclease 4 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q10002 2.06e-92 281 47 2 280 2 apn-1 Apurinic-apyrimidinic endonuclease Caenorhabditis elegans
A0A509ASK2 7.52e-91 281 47 1 277 2 APN1 Apurinic-apyrimidinic endonuclease 1 Plasmodium berghei (strain Anka)
Q8IE02 2.37e-90 282 48 1 272 1 APN1 Apurinic-apyrimidinic endonuclease 1 Plasmodium falciparum (isolate 3D7)
Q966U0 8.09e-88 274 48 1 275 1 apnA Endonuclease 4 homolog Dictyostelium discoideum
Q6MED0 1.62e-82 252 48 4 275 3 nfo Probable endonuclease 4 Protochlamydia amoebophila (strain UWE25)
Q824X6 8.45e-74 230 41 4 281 3 nfo Probable endonuclease 4 Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
P22936 2.74e-72 229 43 3 278 1 APN1 Apurinic-apyrimidinic endonuclease 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B8G418 4.18e-72 226 42 4 285 3 nfo Probable endonuclease 4 Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q5L798 1.99e-71 224 41 4 281 3 nfo Probable endonuclease 4 Chlamydia abortus (strain DSM 27085 / S26/3)
B9LAM9 1.17e-69 219 41 4 283 3 nfo Probable endonuclease 4 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WII8 1.17e-69 219 41 4 283 3 nfo Probable endonuclease 4 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A9B5N7 1.74e-69 219 42 4 280 3 nfo Probable endonuclease 4 Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q74FS7 1.88e-69 219 43 4 267 3 nfo Probable endonuclease 4 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A1WXM0 3.5e-68 216 42 5 281 3 nfo Probable endonuclease 4 Halorhodospira halophila (strain DSM 244 / SL1)
Q9Z7H3 8.14e-68 215 39 4 284 3 nfo Probable endonuclease 4 Chlamydia pneumoniae
P50525 6.05e-67 214 41 3 262 5 apn1 Apurinic-apyrimidinic endonuclease 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B9M4N1 7.57e-67 212 43 4 267 3 nfo Probable endonuclease 4 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B3E325 1.44e-65 209 40 4 281 3 nfo Probable endonuclease 4 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
C6DYE3 2.54e-65 208 41 4 284 3 nfo Probable endonuclease 4 Geobacter sp. (strain M21)
B5EAS8 7.35e-65 207 40 3 280 3 nfo Probable endonuclease 4 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q9PJB8 8.72e-65 207 38 4 279 3 nfo Probable endonuclease 4 Chlamydia muridarum (strain MoPn / Nigg)
O84630 8.95e-63 202 37 4 279 3 nfo Probable endonuclease 4 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KL70 8.95e-63 202 37 4 279 3 nfo Probable endonuclease 4 Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0BA79 4.3e-62 200 37 4 279 3 nfo Probable endonuclease 4 Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B8K0 4.3e-62 200 37 4 279 3 nfo Probable endonuclease 4 Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
A6LMU8 1.9e-60 196 37 1 262 3 nfo Probable endonuclease 4 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q30YP7 6.53e-59 192 41 4 265 3 nfo Probable endonuclease 4 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B7IDS7 1.12e-58 191 37 1 262 3 nfo Probable endonuclease 4 Thermosipho africanus (strain TCF52B)
A9A555 9.7e-58 189 39 1 259 3 nfo Probable endonuclease 4 Nitrosopumilus maritimus (strain SCM1)
A3CT71 6.85e-57 187 38 3 264 3 nfo Probable endonuclease 4 Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
A0RYW7 1.38e-56 186 39 1 259 3 nfo Probable endonuclease 4 Cenarchaeum symbiosum (strain A)
B1L9C6 1.18e-55 184 37 1 262 3 nfo Probable endonuclease 4 Thermotoga sp. (strain RQ2)
B9KBS2 2.63e-55 183 36 1 262 3 nfo Probable endonuclease 4 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q9WYJ7 7.89e-55 182 36 1 262 1 nfo Probable endonuclease 4 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A5IK54 1.32e-54 181 36 1 262 3 nfo Probable endonuclease 4 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9HJS3 1.98e-54 180 38 7 262 3 nfo Probable endonuclease 4 Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q72CQ9 2.15e-54 180 38 3 282 3 nfo Probable endonuclease 4 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B8CW79 5.34e-54 179 38 3 260 3 nfo Probable endonuclease 4 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A1VEI5 3.28e-53 177 37 3 282 3 nfo Probable endonuclease 4 Nitratidesulfovibrio vulgaris (strain DP4)
B8GKX5 5.82e-53 177 36 3 266 3 nfo Probable endonuclease 4 Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Q97A09 3.57e-51 172 38 6 260 3 nfo Probable endonuclease 4 Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
A9BJ15 4.06e-51 172 33 2 268 3 nfo Probable endonuclease 4 Petrotoga mobilis (strain DSM 10674 / SJ95)
B0TD39 9.57e-51 171 35 4 279 3 nfo Probable endonuclease 4 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
O67551 1.08e-50 171 35 4 264 3 nfo Probable endonuclease 4 Aquifex aeolicus (strain VF5)
Q189A4 1.32e-49 168 35 3 262 3 nfo Probable endonuclease 4 Clostridioides difficile (strain 630)
Q2NFM3 4.59e-47 161 33 5 282 3 nfo Probable endonuclease 4 Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
B2UQE3 4.92e-47 161 32 4 277 3 nfo Probable endonuclease 4 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q3IMK8 1.12e-46 160 36 5 280 3 nfo Probable endonuclease 4 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
B3DS13 9.18e-46 158 33 6 282 3 nfo Probable endonuclease 4 Bifidobacterium longum (strain DJO10A)
Q5WHC2 1.57e-45 158 35 5 262 3 nfo Probable endonuclease 4 Shouchella clausii (strain KSM-K16)
Q8G689 3.5e-45 157 34 7 287 3 nfo Probable endonuclease 4 Bifidobacterium longum (strain NCC 2705)
Q9KD33 3.87e-45 157 34 6 267 3 nfo Probable endonuclease 4 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q6GGE2 4.02e-44 154 32 5 262 1 nfo Probable endonuclease 4 Staphylococcus aureus (strain MRSA252)
B2TL64 4.07e-44 154 34 4 278 3 nfo Probable endonuclease 4 Clostridium botulinum (strain Eklund 17B / Type B)
A8Z497 4.11e-44 154 32 5 262 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain USA300 / TCH1516)
A6QHA0 4.11e-44 154 32 5 262 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain Newman)
Q5HFK3 4.11e-44 154 32 5 262 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain COL)
Q2YT22 4.11e-44 154 32 5 262 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FY16 4.11e-44 154 32 5 262 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FGG6 4.11e-44 154 32 5 262 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain USA300)
A8ML82 8.96e-44 153 33 3 264 3 nfo Probable endonuclease 4 Alkaliphilus oremlandii (strain OhILAs)
A6LQV9 1.04e-43 152 32 4 279 3 nfo Probable endonuclease 4 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q8EWT2 1.23e-43 153 33 8 286 3 nfo Probable endonuclease 4 Malacoplasma penetrans (strain HF-2)
Q7NBA9 1.71e-43 153 36 7 271 3 nfo Probable endonuclease 4 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
B2V158 1.8e-43 152 33 4 281 3 nfo Probable endonuclease 4 Clostridium botulinum (strain Alaska E43 / Type E3)
P63539 3.67e-43 152 32 5 262 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain MW2)
Q6G909 3.67e-43 152 32 5 262 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain MSSA476)
P63538 3.67e-43 152 32 5 262 1 nfo Probable endonuclease 4 Staphylococcus aureus (strain N315)
P63537 3.67e-43 152 32 5 262 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IT85 3.67e-43 152 32 5 262 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain JH9)
A6U229 3.67e-43 152 32 5 262 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain JH1)
A7X2V2 3.67e-43 152 32 5 262 3 nfo Probable endonuclease 4 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q9HSK7 2.81e-42 149 36 4 263 3 nfo Probable endonuclease 4 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R2U6 2.81e-42 149 36 4 263 3 nfo Probable endonuclease 4 Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
B7GH81 3.46e-42 149 32 5 265 3 nfo Probable endonuclease 4 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A9NFH1 3.8e-42 149 34 6 269 3 nfo Probable endonuclease 4 Acholeplasma laidlawii (strain PG-8A)
Q72KH8 9.58e-42 147 36 9 276 1 nfo Endonuclease 4 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B7GRN1 2.15e-41 147 32 7 287 3 nfo Probable endonuclease 4 Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q18KA6 3.81e-41 146 34 4 264 3 nfo Probable endonuclease 4 Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q49Y00 3.98e-41 146 32 5 262 3 nfo Probable endonuclease 4 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q5V0S8 4.31e-41 146 34 5 274 3 nfo Probable endonuclease 4 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
C5D4R0 5.64e-41 146 32 9 292 3 nfo Probable endonuclease 4 Geobacillus sp. (strain WCH70)
Q8EPZ2 1.66e-40 145 33 6 269 3 nfo Probable endonuclease 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5KX27 1.82e-40 145 32 8 290 1 nfo Probable endonuclease 4 Geobacillus kaustophilus (strain HTA426)
Q8CP25 1.77e-39 142 32 7 266 3 nfo Probable endonuclease 4 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNZ1 1.77e-39 142 32 7 266 3 nfo Probable endonuclease 4 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B9DNM8 2.08e-39 142 30 5 262 3 nfo Probable endonuclease 4 Staphylococcus carnosus (strain TM300)
C0QRI1 4.61e-39 140 31 6 283 3 nfo Probable endonuclease 4 Persephonella marina (strain DSM 14350 / EX-H1)
Q4L6Q7 5.35e-39 141 30 5 262 3 nfo Probable endonuclease 4 Staphylococcus haemolyticus (strain JCSC1435)
A4IR02 1.89e-38 139 33 10 293 3 nfo Probable endonuclease 4 Geobacillus thermodenitrificans (strain NG80-2)
P54476 2.42e-38 139 30 5 265 3 nfo Probable endonuclease 4 Bacillus subtilis (strain 168)
Q65HA0 3.19e-38 139 32 5 265 3 nfo Probable endonuclease 4 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A7GSY1 3.34e-38 139 33 7 268 3 nfo Probable endonuclease 4 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q03F56 3.46e-38 139 30 8 289 3 nfo Probable endonuclease 4 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q3ABA7 3.52e-38 138 33 5 278 3 nfo Probable endonuclease 4 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A2SPZ6 4.24e-38 138 32 4 270 3 nfo Probable endonuclease 4 Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
B2V7A4 1.48e-37 137 32 6 285 3 nfo Probable endonuclease 4 Sulfurihydrogenibium sp. (strain YO3AOP1)
Q81LV1 2.32e-37 137 32 7 268 1 nfo Probable endonuclease 4 Bacillus anthracis
C3LKW3 2.32e-37 137 32 7 268 3 nfo Probable endonuclease 4 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P8J1 2.32e-37 137 32 7 268 3 nfo Probable endonuclease 4 Bacillus anthracis (strain A0248)
A9VHR4 2.87e-37 136 32 7 268 3 nfo Probable endonuclease 4 Bacillus mycoides (strain KBAB4)
Q6HDN3 3.94e-37 136 32 7 268 3 nfo Probable endonuclease 4 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q634Q3 3.94e-37 136 32 7 268 3 nfo Probable endonuclease 4 Bacillus cereus (strain ZK / E33L)
C1ES07 3.94e-37 136 32 7 268 3 nfo Probable endonuclease 4 Bacillus cereus (strain 03BB102)
A0RIQ8 3.94e-37 136 32 7 268 3 nfo Probable endonuclease 4 Bacillus thuringiensis (strain Al Hakam)
B7JN09 4.02e-37 136 32 7 268 3 nfo Probable endonuclease 4 Bacillus cereus (strain AH820)
Q92BR0 4.1e-37 136 32 6 267 3 nfo Probable endonuclease 4 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A7Z6S8 4.1e-37 136 32 5 265 3 nfo Probable endonuclease 4 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q01TU5 4.94e-37 135 32 6 269 3 nfo Probable endonuclease 4 Solibacter usitatus (strain Ellin6076)
Q67S99 1.18e-36 134 33 7 280 3 nfo Probable endonuclease 4 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B9IY53 1.37e-36 135 32 7 268 3 nfo Probable endonuclease 4 Bacillus cereus (strain Q1)
B7HPI4 1.37e-36 135 32 7 268 3 nfo Probable endonuclease 4 Bacillus cereus (strain AH187)
Q834D0 1.94e-36 134 31 6 266 3 nfo Probable endonuclease 4 Enterococcus faecalis (strain ATCC 700802 / V583)
Q818H3 2.7e-36 134 32 7 268 3 nfo Probable endonuclease 4 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HCQ9 2.7e-36 134 32 7 268 3 nfo Probable endonuclease 4 Bacillus cereus (strain B4264)
B7IYD6 3.03e-36 134 32 7 268 3 nfo Probable endonuclease 4 Bacillus cereus (strain G9842)
B1HTF6 4.2e-36 133 31 6 266 3 nfo Probable endonuclease 4 Lysinibacillus sphaericus (strain C3-41)
A0AIQ1 4.92e-36 133 31 8 294 3 nfo Probable endonuclease 4 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q8Y756 5.08e-36 133 31 8 294 3 nfo Probable endonuclease 4 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9PQI5 6.07e-36 133 30 6 277 3 nfo Probable endonuclease 4 Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1YL88 7.15e-36 133 32 8 288 3 nfo Probable endonuclease 4 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q38XB2 8.57e-36 132 32 7 291 3 nfo Probable endonuclease 4 Latilactobacillus sakei subsp. sakei (strain 23K)
Q71ZM1 8.71e-36 132 31 6 267 3 nfo Probable endonuclease 4 Listeria monocytogenes serotype 4b (strain F2365)
C1KV96 9.38e-36 132 31 6 267 3 nfo Probable endonuclease 4 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q2NJF9 5.91e-35 130 35 5 214 3 nfo Probable endonuclease 4 Aster yellows witches'-broom phytoplasma (strain AYWB)
Q2RJF1 9.98e-35 129 30 6 282 3 nfo Probable endonuclease 4 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q9S2N2 1.06e-34 129 31 3 263 3 nfo Probable endonuclease 4 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q6YQC1 3.55e-34 128 33 5 216 3 nfo Probable endonuclease 4 Onion yellows phytoplasma (strain OY-M)
Q601Y6 4.36e-34 127 35 6 214 3 nfo Probable endonuclease 4 Mesomycoplasma hyopneumoniae (strain 232)
Q4AAX4 4.5e-34 127 35 6 214 3 nfo Probable endonuclease 4 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q82AG6 6.99e-34 128 30 4 266 3 nfo Probable endonuclease 4 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q4A8V0 8.84e-34 127 35 6 214 3 nfo Probable endonuclease 4 Mesomycoplasma hyopneumoniae (strain 7448)
B5ZBB4 1.13e-33 127 28 5 277 3 nfo Probable endonuclease 4 Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
Q4A6S5 1.3e-33 126 33 5 213 3 nfo Probable endonuclease 4 Mycoplasmopsis synoviae (strain 53)
Q6F1D3 2.86e-33 126 32 3 215 3 nfo Probable endonuclease 4 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
B0S196 4.36e-33 125 29 5 264 3 nfo Probable endonuclease 4 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q6MUC7 4.04e-32 122 28 5 274 3 nfo Probable endonuclease 4 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q88VR2 5.44e-32 122 29 6 269 3 nfo Probable endonuclease 4 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q6KH96 3.27e-31 120 27 7 277 3 nfo Probable endonuclease 4 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
A9KNS9 7.55e-31 119 28 5 265 3 nfo Probable endonuclease 4 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
P47477 1.2e-30 119 27 5 270 3 nfo Probable endonuclease 4 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
A5IYT8 3.4e-30 117 30 8 247 3 nfo Probable endonuclease 4 Mycoplasmopsis agalactiae (strain NCTC 10123 / CIP 59.7 / PG2)
Q2ST57 1.9e-29 115 27 5 267 3 nfo Probable endonuclease 4 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
B2A499 1.28e-28 113 28 4 263 3 nfo Probable endonuclease 4 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
P75457 1.44e-28 113 29 3 226 3 nfo Probable endonuclease 4 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q98PU8 4.14e-27 109 34 7 220 3 nfo Probable endonuclease 4 Mycoplasmopsis pulmonis (strain UAB CTIP)
B3PMH1 4.3e-25 103 29 5 217 3 nfo Probable endonuclease 4 Metamycoplasma arthritidis (strain 158L3-1)
Q5UPY4 3.86e-24 102 29 9 284 3 MIMI_R296 Putative endonuclease 4 Acanthamoeba polyphaga mimivirus
P9WQ13 2.48e-15 77 28 9 262 1 end Probable endonuclease 4 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ12 2.48e-15 77 28 9 262 3 end Probable endonuclease 4 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U056 2.48e-15 77 28 9 262 3 nfo Probable endonuclease 4 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AL03 2.48e-15 77 28 9 262 3 nfo Probable endonuclease 4 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KGF0 2.48e-15 77 28 9 262 3 nfo Probable endonuclease 4 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P63536 2.48e-15 77 28 9 262 3 nfo Probable endonuclease 4 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P30770 4.88e-14 73 28 10 261 3 nfo Probable endonuclease 4 Mycobacterium leprae (strain TN)
B8ZSC5 4.88e-14 73 28 10 261 3 nfo Probable endonuclease 4 Mycobacterium leprae (strain Br4923)
O86954 3.31e-13 67 40 0 82 3 nfo Probable endonuclease 4 (Fragment) Thermotoga neapolitana
A0PM27 4.62e-13 70 28 9 260 3 nfo Probable endonuclease 4 Mycobacterium ulcerans (strain Agy99)
B2HSJ8 5.14e-13 70 28 9 260 3 nfo Probable endonuclease 4 Mycobacterium marinum (strain ATCC BAA-535 / M)
P42691 4.38e-11 60 74 0 31 3 nfo Probable endonuclease 4 (Fragment) Yersinia enterocolitica
Q65246 4.4e-06 50 25 7 163 3 Mal-142 Probable AP endonuclease African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983)
P0C9C6 1.59e-05 48 25 7 163 1 Pret-146 Probable AP endonuclease African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996)
P0C9C7 1.65e-05 48 25 7 163 3 War-144 Probable AP endonuclease African swine fever virus (isolate Warthog/Namibia/Wart80/1980)
Q65202 1.65e-05 48 25 7 163 1 Ba71V-134 Probable AP endonuclease African swine fever virus (strain Badajoz 1971 Vero-adapted)
P0C9C8 0.000236 45 25 7 164 3 Ken-146 Probable AP endonuclease African swine fever virus (isolate Pig/Kenya/KEN-50/1950)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07630
Feature type CDS
Gene nfo
Product deoxyribonuclease IV
Location 1597277 - 1598119 (strand: 1)
Length 843 (nucleotides) / 280 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1977
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01261 Xylose isomerase-like TIM barrel

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0648 Replication, recombination and repair (L) L Endonuclease IV

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01151 deoxyribonuclease IV [EC:3.1.21.2] Base excision repair -

Protein Sequence

MKYVGAHVSALGGVDQAVLRAHEIGATAFALFTKNQRQWKAAPLSEKVITAFKANCKKYGYGKGQILPHDSYLINLGHPEQEALDKSRDAFLDELQRCEQLGIDRINFHPGSFLNKIAVDDCLKRIAESINIALDKTSGVIAVIENTAGQGTNLGFRFEQLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTAETCKATFDEFERVVGFEYLKGMHLNDAKSEFASRVDRHDSLGIGKIGNAPFEFIMKDKRFNGIPMVLETVNPDIWPQEIAWLKSLEK

Flanking regions ( +/- flanking 50bp)

AATCTCCTTTTTCTTATGCCATAATCGACACAAAGAAGGAGAATAAAAAAATGAAATATGTAGGAGCACACGTCAGCGCCCTCGGGGGTGTTGATCAGGCCGTTTTACGCGCACATGAGATAGGTGCCACAGCATTCGCCCTGTTCACCAAAAATCAGCGCCAGTGGAAAGCGGCTCCCTTGTCAGAAAAAGTCATTACCGCATTCAAAGCCAACTGCAAAAAATACGGTTACGGAAAAGGTCAGATCCTGCCTCATGACAGTTACCTGATTAACCTCGGACACCCGGAGCAGGAAGCGCTGGATAAATCCCGCGATGCCTTTCTGGATGAGTTACAGCGCTGTGAGCAGTTAGGGATTGATCGCATCAACTTTCACCCCGGCAGTTTTCTGAACAAAATCGCGGTTGATGATTGCCTGAAACGCATTGCTGAATCCATTAATATTGCGCTGGATAAGACAAGCGGCGTGATTGCTGTAATAGAGAACACCGCCGGTCAGGGCACCAATCTCGGATTTCGTTTTGAACAGCTTGCCGCCATTATTGACGGCGTGGAGGATAAATCACGGGTCGGCGTTTGTATCGATACCTGTCACGCCTTCGCCGCCGGATATGATTTACGGACGGCTGAAACCTGTAAAGCGACGTTTGATGAATTTGAACGCGTAGTCGGATTTGAGTATCTGAAAGGTATGCACCTTAATGATGCAAAAAGTGAATTCGCCAGCCGCGTTGATCGCCACGACAGTCTGGGTATCGGAAAAATCGGTAATGCACCGTTTGAATTTATTATGAAAGATAAACGGTTTAACGGTATCCCGATGGTACTGGAAACCGTTAATCCCGATATCTGGCCGCAGGAAATTGCGTGGCTGAAGTCTCTGGAAAAATAGCCTGGTTCAGACCGGGTTGAGCGTAATTCGTGCCATCATGGCAGCCAGTT