Homologs in group_1699

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_14455 EHELCC_14455 100.0 Morganella morganii S2 astC Acetylornithine/succinyldiaminopimelate/putrescin e aminotransferase
NLDBIP_15550 NLDBIP_15550 100.0 Morganella morganii S4 astC Acetylornithine/succinyldiaminopimelate/putrescin e aminotransferase
LHKJJB_15060 LHKJJB_15060 100.0 Morganella morganii S3 astC Acetylornithine/succinyldiaminopimelate/putrescin e aminotransferase
HKOGLL_14180 HKOGLL_14180 100.0 Morganella morganii S5 astC Acetylornithine/succinyldiaminopimelate/putrescin e aminotransferase
F4V73_RS14800 F4V73_RS14800 92.9 Morganella psychrotolerans - aspartate aminotransferase family protein
PMI_RS13935 PMI_RS13935 74.6 Proteus mirabilis HI4320 - acetylornithine/succinyldiaminopimelate transaminase

Distribution of the homologs in the orthogroup group_1699

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1699

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N9E5 0.0 640 74 0 402 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P59324 0.0 633 74 0 401 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Yersinia pestis
Q8X4S6 0.0 611 70 0 398 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Escherichia coli O157:H7
P18335 0.0 610 70 0 398 1 argD Acetylornithine/succinyldiaminopimelate aminotransferase Escherichia coli (strain K12)
P59317 0.0 610 70 0 398 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8Z1Z3 0.0 604 69 0 398 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Salmonella typhi
P59321 0.0 604 70 0 398 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Shigella flexneri
P40732 0.0 603 69 0 398 1 argD Acetylornithine/succinyldiaminopimelate aminotransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q885K0 0.0 520 61 0 397 3 argD1 Acetylornithine aminotransferase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P59323 0.0 520 59 0 402 3 argD Acetylornithine aminotransferase Vibrio vulnificus (strain CMCP6)
Q7MH19 0.0 520 59 0 402 3 argD Acetylornithine aminotransferase Vibrio vulnificus (strain YJ016)
O30508 0.0 516 61 0 396 1 aruC Succinylornithine transaminase/acetylornithine aminotransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KNW2 0.0 514 59 0 400 3 argD Acetylornithine aminotransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P59320 0.0 514 59 0 402 3 argD Acetylornithine aminotransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q87L20 1.15e-180 511 58 0 400 3 argD Acetylornithine aminotransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P59319 6.82e-180 509 58 0 398 3 argD Acetylornithine aminotransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9CNT1 1.76e-177 503 60 1 399 3 argD Acetylornithine aminotransferase Pasteurella multocida (strain Pm70)
B7LQ44 4.46e-177 502 59 0 396 3 astC Succinylornithine transaminase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A8A0U0 9.28e-177 501 58 0 396 3 astC Succinylornithine transaminase Escherichia coli O9:H4 (strain HS)
Q3Z295 1.91e-176 501 58 0 396 3 astC Succinylornithine transaminase Shigella sonnei (strain Ss046)
B1LDY3 2.35e-176 500 58 0 396 3 astC Succinylornithine transaminase Escherichia coli (strain SMS-3-5 / SECEC)
B6IBG8 2.95e-176 500 58 0 396 3 astC Succinylornithine transaminase Escherichia coli (strain SE11)
P77581 2.95e-176 500 58 0 396 1 astC Succinylornithine transaminase Escherichia coli (strain K12)
B1IPI2 2.95e-176 500 58 0 396 3 astC Succinylornithine transaminase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XGK9 2.95e-176 500 58 0 396 3 astC Succinylornithine transaminase Escherichia coli (strain K12 / DH10B)
C4ZZA4 2.95e-176 500 58 0 396 3 astC Succinylornithine transaminase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1G0 2.95e-176 500 58 0 396 3 astC Succinylornithine transaminase Escherichia coli O8 (strain IAI1)
A7ZML6 2.95e-176 500 58 0 396 3 astC Succinylornithine transaminase Escherichia coli O139:H28 (strain E24377A / ETEC)
P57600 5.24e-176 499 55 0 402 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q321P0 3.13e-175 498 58 0 396 3 astC Succinylornithine transaminase Shigella boydii serotype 4 (strain Sb227)
B2U3D0 3.13e-175 498 58 0 396 3 astC Succinylornithine transaminase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7N584 8.66e-175 496 58 0 396 3 astC Succinylornithine transaminase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NT29 9.45e-175 496 58 0 396 3 astC Succinylornithine transaminase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7L6M2 1.92e-174 495 58 0 396 3 astC Succinylornithine transaminase Escherichia coli (strain 55989 / EAEC)
B7USC9 2.47e-174 495 57 0 396 3 astC Succinylornithine transaminase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q1RB45 7.96e-174 494 58 0 396 3 astC Succinylornithine transaminase Escherichia coli (strain UTI89 / UPEC)
Q8FGZ9 7.96e-174 494 58 0 396 3 astC Succinylornithine transaminase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TH82 7.96e-174 494 58 0 396 3 astC Succinylornithine transaminase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABS9 7.96e-174 494 58 0 396 3 astC Succinylornithine transaminase Escherichia coli O1:K1 / APEC
B7MVM7 7.96e-174 494 58 0 396 3 astC Succinylornithine transaminase Escherichia coli O81 (strain ED1a)
B7MAV9 7.96e-174 494 58 0 396 3 astC Succinylornithine transaminase Escherichia coli O45:K1 (strain S88 / ExPEC)
B5YQ35 1.6e-173 493 58 0 396 3 astC Succinylornithine transaminase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X598 1.6e-173 493 58 0 396 3 astC Succinylornithine transaminase Escherichia coli O157:H7
Q8ZPV2 2.6e-173 493 61 0 391 2 astC Succinylornithine transaminase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5RB01 3.65e-173 492 61 0 391 3 astC Succinylornithine transaminase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QWJ0 3.65e-173 492 61 0 391 3 astC Succinylornithine transaminase Salmonella enteritidis PT4 (strain P125109)
A8AHE0 4.57e-173 492 59 0 391 3 astC Succinylornithine transaminase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5F846 6.24e-173 492 61 0 391 3 astC Succinylornithine transaminase Salmonella agona (strain SL483)
B5BA72 8.76e-173 491 61 0 391 3 astC Succinylornithine transaminase Salmonella paratyphi A (strain AKU_12601)
Q5PHC8 8.76e-173 491 61 0 391 3 astC Succinylornithine transaminase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5FJD8 8.85e-173 491 61 0 391 3 astC Succinylornithine transaminase Salmonella dublin (strain CT_02021853)
Q8Z6F9 1.04e-172 491 61 0 391 3 astC Succinylornithine transaminase Salmonella typhi
A9N278 1.07e-172 491 61 0 391 3 astC Succinylornithine transaminase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
C0Q6X9 1.31e-172 491 61 0 391 3 astC Succinylornithine transaminase Salmonella paratyphi C (strain RKS4594)
B4TGE0 1.31e-172 491 61 0 391 3 astC Succinylornithine transaminase Salmonella heidelberg (strain SL476)
Q57PX9 4.87e-172 489 61 0 391 3 astC Succinylornithine transaminase Salmonella choleraesuis (strain SC-B67)
B4T3Z4 1.89e-171 488 61 0 391 3 astC Succinylornithine transaminase Salmonella newport (strain SL254)
P59086 2.86e-171 487 56 0 393 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A1JS45 2.55e-170 485 57 1 402 3 astC Succinylornithine transaminase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A7FIL6 3.71e-169 482 57 1 402 3 astC Succinylornithine transaminase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7N2G7 6.23e-169 481 56 0 396 3 astC Succinylornithine transaminase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q66B21 6.33e-169 482 57 1 402 3 astC Succinylornithine transaminase Yersinia pseudotuberculosis serotype I (strain IP32953)
A9QZ63 7.96e-169 481 57 1 402 3 astC Succinylornithine transaminase Yersinia pestis bv. Antiqua (strain Angola)
Q8D0D7 7.96e-169 481 57 1 402 3 astC Succinylornithine transaminase Yersinia pestis
Q1C8B1 7.96e-169 481 57 1 402 3 astC Succinylornithine transaminase Yersinia pestis bv. Antiqua (strain Antiqua)
Q9JYY4 2.91e-158 454 56 0 387 3 argD Acetylornithine aminotransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JTX9 3.7e-157 451 55 0 387 3 argD Acetylornithine aminotransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q8R7C1 1.29e-125 371 45 4 394 3 argD Acetylornithine aminotransferase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q87DM8 6.98e-122 362 47 4 390 3 argD Acetylornithine aminotransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PDF2 1.09e-121 362 47 4 390 3 argD Acetylornithine aminotransferase Xylella fastidiosa (strain 9a5c)
Q8PH31 3.13e-121 360 48 3 389 3 argD Acetylornithine aminotransferase Xanthomonas axonopodis pv. citri (strain 306)
Q97GH9 1e-118 353 46 2 365 3 argD Acetylornithine aminotransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8P5Q4 1.13e-113 341 48 3 389 3 argD Acetylornithine aminotransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q92SA0 7.21e-113 338 47 4 393 3 argD Acetylornithine aminotransferase Rhizobium meliloti (strain 1021)
Q58131 7.45e-113 338 43 1 388 3 argD Acetylornithine aminotransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8UI71 8.58e-113 338 47 2 368 3 argD Acetylornithine aminotransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9X2A5 3.24e-111 334 44 5 381 1 argD Acetylornithine aminotransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9AAL3 3.75e-109 329 45 3 384 3 argD1 Acetylornithine aminotransferase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P59318 2.03e-108 327 44 2 376 3 argD Acetylornithine aminotransferase Myxococcus xanthus
Q89VE9 3.71e-108 327 43 2 392 3 argD1 Acetylornithine aminotransferase 1 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q07907 4.72e-108 326 43 3 386 3 argD Acetylornithine aminotransferase Geobacillus stearothermophilus
P30900 3.57e-106 321 43 2 381 3 argD Acetylornithine aminotransferase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q9K8V5 8.71e-105 317 42 3 384 3 argD Acetylornithine aminotransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q98BB7 1.82e-104 317 44 3 368 3 argD Acetylornithine aminotransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P59322 3.78e-104 317 42 3 396 3 argD Acetylornithine aminotransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P54752 1.29e-102 313 42 3 397 3 argD Acetylornithine aminotransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P63567 6.19e-101 308 43 2 368 3 argD Acetylornithine aminotransferase Brucella suis biovar 1 (strain 1330)
P63566 6.19e-101 308 43 2 368 3 argD Acetylornithine aminotransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q7WDN7 4.2e-100 306 43 6 393 3 argD2 Acetylornithine aminotransferase 2 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W2N9 4.34e-100 306 43 6 393 3 argD2 Acetylornithine aminotransferase 2 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7NN66 8.45e-100 305 42 4 396 3 argD Acetylornithine aminotransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
O66442 1.04e-99 304 41 6 379 1 argD Acetylornithine aminotransferase Aquifex aeolicus (strain VF5)
Q7VSH3 1.43e-99 305 43 6 393 3 argD2 Acetylornithine aminotransferase 2 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P73133 1.7e-99 305 41 4 397 1 argD Acetylornithine aminotransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6C846 1.93e-99 305 41 7 407 3 ARG8 Acetylornithine aminotransferase, mitochondrial Yarrowia lipolytica (strain CLIB 122 / E 150)
P36839 6.74e-99 302 42 5 387 3 argD Acetylornithine aminotransferase Bacillus subtilis (strain 168)
Q9A652 2.59e-98 301 43 4 385 3 argD2 Acetylornithine aminotransferase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q55DT8 1.7e-96 298 41 7 387 3 argD Probable acetylornithine aminotransferase, mitochondrial Dictyostelium discoideum
Q5SHH5 2.82e-96 296 42 5 379 1 lysJ [LysW]-aminoadipate semialdehyde transaminase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q818W2 5.66e-96 295 39 2 373 3 argD Acetylornithine aminotransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q93R93 1.12e-95 295 41 5 379 1 lysJ [LysW]-aminoadipate semialdehyde transaminase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q59282 1.42e-95 294 39 7 404 1 argD Acetylornithine aminotransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q9PIR7 2.52e-95 293 40 4 391 1 argD Acetylornithine aminotransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q81M98 3.3e-95 293 40 2 373 3 argD Acetylornithine aminotransferase Bacillus anthracis
Q75AW1 2.08e-94 292 41 6 398 3 ARG8 Acetylornithine aminotransferase, mitochondrial Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q882K8 1.27e-92 287 39 6 399 3 argD2 Acetylornithine aminotransferase 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
O27392 5.18e-92 285 38 2 387 3 argD Acetylornithine aminotransferase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8FTN2 2.08e-91 284 40 8 394 3 argD Acetylornithine aminotransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8Y6U4 2.13e-91 283 40 4 387 3 argD Acetylornithine aminotransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q7V0G0 5.27e-91 283 39 4 388 3 argD Acetylornithine aminotransferase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
O14433 7.06e-91 283 38 7 394 3 ARG8 Acetylornithine aminotransferase, mitochondrial Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q9M8M7 1.82e-90 283 38 4 392 1 WIN1 Acetylornithine aminotransferase, chloroplastic/mitochondrial Arabidopsis thaliana
Q7WKW5 5.97e-90 280 41 6 393 3 argD1 Acetylornithine aminotransferase 1 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q71Z79 8.02e-90 279 40 4 387 3 argD Acetylornithine aminotransferase Listeria monocytogenes serotype 4b (strain F2365)
O74548 8.16e-90 281 37 6 398 2 arg1 Probable acetylornithine aminotransferase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8CUM9 8.79e-90 280 39 3 387 3 argD Acetylornithine aminotransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8TUZ5 2.2e-89 278 40 7 382 3 argD Acetylornithine aminotransferase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q7W7H6 2.62e-89 278 41 6 393 3 argD1 Acetylornithine aminotransferase 1 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7VTJ7 4.65e-89 278 41 6 393 3 argD1 Acetylornithine aminotransferase 1 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P18544 2.52e-88 276 37 7 394 1 ARG8 Acetylornithine aminotransferase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q7VMS5 8.38e-88 274 39 6 387 3 argD Acetylornithine aminotransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q59928 1.2e-87 273 39 5 383 3 argD Acetylornithine aminotransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8XWN8 1.78e-87 274 42 7 385 3 argD Acetylornithine aminotransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q92BC0 3.16e-87 273 39 6 387 3 argD Acetylornithine aminotransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q7V8L1 4.69e-87 273 40 3 383 3 argD Acetylornithine aminotransferase Prochlorococcus marinus (strain MIT 9313)
A0QYS9 1.09e-86 271 38 5 395 1 argD Acetylornithine aminotransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q7VAS9 1.88e-86 271 39 3 387 3 argD Acetylornithine aminotransferase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q8TUE8 2.01e-86 271 38 5 375 3 argD Acetylornithine aminotransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q7U5R5 2.11e-86 271 40 3 400 3 argD Acetylornithine aminotransferase Parasynechococcus marenigrum (strain WH8102)
Q9P3I3 2.7e-86 273 36 5 395 3 arg-8 Acetylornithine aminotransferase, mitochondrial Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q4A0N2 5.8e-86 270 36 4 384 3 rocD1 Ornithine aminotransferase 1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8PX16 6.04e-86 270 38 5 375 3 argD Acetylornithine aminotransferase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q49W96 2.45e-85 268 38 4 379 3 rocD2 Ornithine aminotransferase 2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P9WPZ7 6.74e-85 267 39 5 392 1 argD Acetylornithine aminotransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPZ6 6.74e-85 267 39 5 392 3 argD Acetylornithine aminotransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63569 6.74e-85 267 39 5 392 3 argD Acetylornithine aminotransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O04866 1.09e-84 268 37 6 392 2 AG118 Acetylornithine aminotransferase, mitochondrial Alnus glutinosa
Q6FXA4 3.81e-84 266 38 10 399 3 ARG8 Acetylornithine aminotransferase, mitochondrial Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
O30156 3.84e-83 262 36 3 378 3 argD Acetylornithine aminotransferase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
B9DIU0 4.71e-83 262 36 5 403 3 rocD Ornithine aminotransferase Staphylococcus carnosus (strain TM300)
Q6GKC1 2.21e-82 260 36 4 374 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain MRSA252)
P60299 2.29e-82 260 37 4 379 3 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain MW2)
Q6GAW9 2.29e-82 260 37 4 379 3 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain MSSA476)
P60298 2.29e-82 260 37 4 379 1 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain N315)
P60297 2.29e-82 260 37 4 379 3 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HHC8 2.29e-82 260 37 4 379 3 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain COL)
Q6GID1 3.93e-82 260 37 4 379 3 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain MRSA252)
Q8NYM5 8.04e-82 259 36 5 377 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain MW2)
Q6GCU1 8.04e-82 259 36 5 377 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain MSSA476)
Q5HJI8 8.04e-82 259 36 5 377 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain COL)
P59316 8.88e-82 259 36 2 382 3 argD Acetylornithine aminotransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P60296 8.95e-82 259 36 5 377 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain N315)
P60295 8.95e-82 259 36 5 377 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6BUP9 3.25e-81 259 38 6 396 3 ARG8 Acetylornithine aminotransferase, mitochondrial Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q828A3 4.01e-81 257 38 6 401 3 argD Acetylornithine aminotransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9CHD3 1.56e-80 255 38 8 384 3 argD Acetylornithine aminotransferase Lactococcus lactis subsp. lactis (strain IL1403)
Q8CSG1 1.62e-80 255 38 5 372 3 argD Acetylornithine aminotransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q4JAP8 2.63e-80 255 36 4 386 1 lysJ [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q9L1A4 3.01e-80 255 41 5 356 3 argD Acetylornithine aminotransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9CC12 3.47e-80 255 37 9 408 3 argD Acetylornithine aminotransferase Mycobacterium leprae (strain TN)
Q82UP3 4.37e-80 254 37 5 395 3 argD Acetylornithine aminotransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q5HP24 2.47e-79 252 38 5 372 3 argD Acetylornithine aminotransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8EP32 2.76e-79 253 35 4 385 3 rocD Ornithine aminotransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P59315 2.8e-79 253 36 7 416 3 argD Acetylornithine aminotransferase Bifidobacterium longum (strain NCC 2705)
Q8CT82 4.37e-79 252 36 4 384 3 rocD Ornithine aminotransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQK4 7.56e-79 251 36 4 384 3 rocD Ornithine aminotransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q976K0 1.36e-78 250 37 4 376 3 lysJ [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q9LCS5 1.18e-77 248 38 8 407 3 argD Acetylornithine aminotransferase Streptomyces clavuligerus
Q89LG2 2.58e-77 248 40 4 389 3 argD2 Acetylornithine aminotransferase 2 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q7MAE6 4.59e-77 246 38 7 376 3 argD Acetylornithine aminotransferase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B9EAM9 5.49e-77 246 37 4 386 3 rocD Ornithine aminotransferase Macrococcus caseolyticus (strain JCSC5402)
C5D6R2 3.47e-76 244 36 4 384 3 rocD Ornithine aminotransferase Geobacillus sp. (strain WCH70)
P24087 3.62e-76 245 35 3 395 3 argD Acetylornithine aminotransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72RH8 3.62e-76 245 35 3 395 3 argD Acetylornithine aminotransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
C4L2E7 8.56e-76 244 36 4 383 3 rocD Ornithine aminotransferase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
C0ZBR4 1.32e-75 243 36 5 402 3 rocD Ornithine aminotransferase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q5JFW3 1.62e-75 241 36 5 375 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P38021 2.24e-75 243 36 4 385 1 rocD Ornithine aminotransferase Bacillus subtilis (strain 168)
Q8U0B4 3.28e-75 241 36 7 375 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q7RT90 5.28e-75 242 34 5 392 1 OAT Ornithine aminotransferase Plasmodium yoelii yoelii
Q7VSA0 1.32e-74 241 35 6 394 3 rocD Ornithine aminotransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W1E4 1.32e-74 241 35 6 394 3 rocD Ornithine aminotransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WP51 1.32e-74 241 35 6 394 3 rocD Ornithine aminotransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q07805 2.17e-74 240 34 7 406 2 OAT Ornithine aminotransferase Plasmodium falciparum (isolate CDC / Honduras)
Q6LFH8 2.17e-74 240 34 7 406 1 OAT Ornithine aminotransferase Plasmodium falciparum (isolate 3D7)
B9ITF9 8.59e-74 238 35 4 384 3 rocD Ornithine aminotransferase Bacillus cereus (strain Q1)
C1EL61 3.35e-73 237 35 4 384 3 rocD Ornithine aminotransferase Bacillus cereus (strain 03BB102)
Q9RW75 3.96e-73 238 35 7 388 3 lysJ [LysW]-aminoadipate semialdehyde transaminase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q7SI94 7.41e-73 236 35 4 376 3 lysJ [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q81TV3 8.98e-73 236 35 4 384 1 rocD Ornithine aminotransferase Bacillus anthracis
C3LBX0 8.98e-73 236 35 4 384 3 rocD Ornithine aminotransferase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P3K3 8.98e-73 236 35 4 384 3 rocD Ornithine aminotransferase Bacillus anthracis (strain A0248)
Q9K5Z2 1.83e-72 235 36 5 384 3 rocD Ornithine aminotransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q18040 3.07e-72 235 35 8 389 3 oatr-1 Probable ornithine aminotransferase, mitochondrial Caenorhabditis elegans
Q4XWV5 5.22e-72 234 33 5 392 3 OAT Ornithine aminotransferase Plasmodium chabaudi chabaudi
P04181 6.52e-72 235 35 6 388 1 OAT Ornithine aminotransferase, mitochondrial Homo sapiens
P04182 7.99e-72 234 35 6 388 1 Oat Ornithine aminotransferase, mitochondrial Rattus norvegicus
P22256 1.07e-71 234 33 12 433 1 gabT 4-aminobutyrate aminotransferase GabT Escherichia coli (strain K12)
Q81GP2 4.73e-71 231 34 4 384 3 rocD Ornithine aminotransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P29758 6.01e-71 232 34 6 388 1 Oat Ornithine aminotransferase, mitochondrial Mus musculus
Q89RB7 1.14e-69 228 33 6 390 3 rocD Ornithine aminotransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
O08321 1.16e-69 227 37 6 383 3 argD Acetylornithine aminotransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8ZV07 2.74e-69 226 36 6 365 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q5JEW1 5.63e-69 227 34 11 410 1 TK2101 Ornithine aminotransferase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
O59401 1.41e-68 224 35 6 377 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q3ZCF5 1.49e-68 226 35 6 388 2 OAT Ornithine aminotransferase, mitochondrial Bos taurus
Q9I6M4 3.09e-68 225 34 11 428 1 davT 5-aminovalerate aminotransferase DavT Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q92413 3.11e-68 226 31 9 414 1 otaA Ornithine aminotransferase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q10G56 1.15e-66 222 32 6 397 2 OAT Ornithine aminotransferase, mitochondrial Oryza sativa subsp. japonica
P50457 1.15e-65 218 35 8 405 1 puuE 4-aminobutyrate aminotransferase PuuE Escherichia coli (strain K12)
Q9V1I4 1.16e-65 216 36 6 366 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Pyrococcus abyssi (strain GE5 / Orsay)
Q6CWC1 3.25e-65 217 32 9 405 1 CAR2 Ornithine aminotransferase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q9VW26 9.4e-65 216 33 7 384 2 Oat Ornithine aminotransferase, mitochondrial Drosophila melanogaster
P49724 2.94e-64 214 33 7 384 1 Oat Ornithine aminotransferase, mitochondrial Drosophila ananassae
Q9FNK4 1.32e-63 214 33 7 395 1 DELTA-OAT Ornithine aminotransferase, mitochondrial Arabidopsis thaliana
Q54JP5 5.18e-63 211 31 4 390 3 oatA Probable ornithine aminotransferase Dictyostelium discoideum
Q9ZJ10 1.21e-62 204 45 2 231 3 argD Acetylornithine aminotransferase (Fragment) Bacillus amyloliquefaciens
Q88RB9 1.52e-62 210 34 11 399 1 davT 5-aminovalerate aminotransferase DavT Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9P7L5 1.64e-61 207 31 10 422 2 car2 Ornithine aminotransferase car2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
H3ZR39 2.74e-61 207 30 9 438 1 OCC_10945 Leucine/methionine racemase Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
P30268 1.15e-60 206 32 11 418 3 BpOF4_10225 Uncharacterized aminotransferase BpOF4_10225 Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
P94427 1.4e-60 205 32 10 410 3 gabT Probable 4-aminobutyrate aminotransferase Bacillus subtilis (strain 168)
Q88FI7 1.57e-60 204 34 11 408 1 PP_4108 2-aminoadipate transaminase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P07991 2.46e-59 201 33 12 406 1 CAR2 Ornithine aminotransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9YBY6 1.56e-58 198 33 9 375 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q31WW1 1.55e-56 195 35 6 328 3 patA Putrescine aminotransferase Shigella boydii serotype 4 (strain Sb227)
A8A4N0 2.09e-55 192 35 6 328 3 patA Putrescine aminotransferase Escherichia coli O9:H4 (strain HS)
P42588 2.25e-55 192 35 6 328 1 patA Putrescine aminotransferase Escherichia coli (strain K12)
B1XG77 2.25e-55 192 35 6 328 3 patA Putrescine aminotransferase Escherichia coli (strain K12 / DH10B)
C4ZQY9 2.25e-55 192 35 6 328 3 patA Putrescine aminotransferase Escherichia coli (strain K12 / MC4100 / BW2952)
Q1R6Q7 3.19e-55 192 35 6 321 3 patA Putrescine aminotransferase Escherichia coli (strain UTI89 / UPEC)
B6I445 3.19e-55 192 35 6 321 3 patA Putrescine aminotransferase Escherichia coli (strain SE11)
A1AFZ3 3.19e-55 192 35 6 321 3 patA Putrescine aminotransferase Escherichia coli O1:K1 / APEC
B7N0M2 3.19e-55 192 35 6 321 3 patA Putrescine aminotransferase Escherichia coli O81 (strain ED1a)
B5YRB3 3.19e-55 192 35 6 321 3 patA Putrescine aminotransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAN1 3.19e-55 192 35 6 321 3 patA Putrescine aminotransferase Escherichia coli O157:H7
B7LH08 3.19e-55 192 35 6 321 3 patA Putrescine aminotransferase Escherichia coli (strain 55989 / EAEC)
B7MB08 3.19e-55 192 35 6 321 3 patA Putrescine aminotransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIY0 3.19e-55 192 35 6 321 3 patA Putrescine aminotransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZRV6 3.19e-55 192 35 6 321 3 patA Putrescine aminotransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
B1IRP4 3.32e-55 192 35 6 321 3 patA Putrescine aminotransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TD34 6.37e-55 191 35 6 321 3 patA Putrescine aminotransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B1LF65 6.58e-55 191 35 6 321 3 patA Putrescine aminotransferase Escherichia coli (strain SMS-3-5 / SECEC)
B7ND61 7.08e-55 191 35 6 321 3 patA Putrescine aminotransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NJT8 8.29e-55 191 34 6 328 3 patA Putrescine aminotransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q83JJ8 8.46e-55 191 35 6 321 3 patA Putrescine aminotransferase Shigella flexneri
Q0T0J2 8.46e-55 191 35 6 321 3 patA Putrescine aminotransferase Shigella flexneri serotype 5b (strain 8401)
B7LZM2 8.46e-55 191 34 8 323 3 patA Putrescine aminotransferase Escherichia coli O8 (strain IAI1)
P56969 8.62e-55 189 32 8 393 3 AF_1815 Uncharacterized aminotransferase AF_1815 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O57878 1.75e-54 190 27 9 428 1 PH0138 Broad substrate specificity amino-acid racemase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8FDF5 1.82e-54 190 35 6 321 3 patA Putrescine aminotransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7LQF8 2.2e-54 189 35 6 321 3 patA Putrescine aminotransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q3YXH0 3.24e-54 189 34 6 328 3 patA Putrescine aminotransferase Shigella sonnei (strain Ss046)
A6TEB2 5.36e-54 188 35 6 321 3 patA Putrescine aminotransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XTY7 5.53e-54 188 35 6 321 3 patA Putrescine aminotransferase Klebsiella pneumoniae (strain 342)
A7MIU0 5.91e-54 188 34 11 382 3 patA Putrescine aminotransferase Cronobacter sakazakii (strain ATCC BAA-894)
A4WEQ6 7.34e-54 188 35 6 328 3 patA Putrescine aminotransferase Enterobacter sp. (strain 638)
P44951 1.78e-53 187 31 12 429 1 dat Diaminobutyrate--2-oxoglutarate aminotransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B5BG29 2.07e-53 187 35 6 328 3 patA Putrescine aminotransferase Salmonella paratyphi A (strain AKU_12601)
Q5PC95 2.07e-53 187 35 6 328 3 patA Putrescine aminotransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z3L9 3.54e-53 186 35 6 328 3 patA Putrescine aminotransferase Salmonella typhi
B4TIU6 3.54e-53 186 35 6 328 3 patA Putrescine aminotransferase Salmonella heidelberg (strain SL476)
B5REH5 4.69e-53 186 35 6 328 3 patA Putrescine aminotransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZ53 4.69e-53 186 35 6 328 3 patA Putrescine aminotransferase Salmonella enteritidis PT4 (strain P125109)
B5FHV3 4.69e-53 186 35 6 328 3 patA Putrescine aminotransferase Salmonella dublin (strain CT_02021853)
A8APX8 5.26e-53 186 34 6 328 3 patA Putrescine aminotransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9N5Z8 1.26e-52 185 34 8 333 3 patA Putrescine aminotransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q8ZLX7 1.38e-52 185 34 6 328 3 patA Putrescine aminotransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TVV2 1.38e-52 185 34 6 328 3 patA Putrescine aminotransferase Salmonella schwarzengrund (strain CVM19633)
B4T688 1.38e-52 185 34 6 328 3 patA Putrescine aminotransferase Salmonella newport (strain SL254)
B5F6B4 1.38e-52 185 34 6 328 3 patA Putrescine aminotransferase Salmonella agona (strain SL483)
Q5JGG6 1.44e-52 184 31 10 440 1 TK1211 Leucine/methionine racemase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q6D6Y6 1.47e-52 185 34 10 396 3 patA Putrescine aminotransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P40829 2.44e-52 184 30 11 432 3 gabT 4-aminobutyrate aminotransferase Mycobacterium leprae (strain TN)
C0PYZ1 3.02e-52 184 34 6 328 3 patA Putrescine aminotransferase Salmonella paratyphi C (strain RKS4594)
Q57JP1 3.02e-52 184 34 6 328 3 patA Putrescine aminotransferase Salmonella choleraesuis (strain SC-B67)
A9MPU4 1.19e-50 179 34 6 328 3 patA Putrescine aminotransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
O50131 1.85e-50 179 31 10 402 1 PH1423 Ornithine aminotransferase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9APM5 3.81e-50 178 29 9 415 1 tpa Taurine--pyruvate aminotransferase Bilophila wadsworthia
E5Y945 3.81e-50 178 29 9 415 1 tpa Taurine--pyruvate aminotransferase Bilophila wadsworthia (strain 3_1_6)
Q17QF0 3.02e-48 174 29 10 421 2 AGXT2 Alanine--glyoxylate aminotransferase 2, mitochondrial Bos taurus
Q7M9K2 2.22e-47 170 29 13 411 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A3UZK3 4.33e-47 171 29 8 418 1 pbfA (R)-1-hydroxy-2-aminoethylphosphonate ammonia-lyase Vibrio splendidus (strain 12B01)
P33189 2.33e-46 168 32 7 346 3 yhxA Uncharacterized aminotransferase YhxA Bacillus subtilis (strain 168)
Q53196 9.76e-46 167 29 9 405 3 NGR_a01380 Uncharacterized aminotransferase y4uB Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q74CT9 1.19e-45 166 29 9 415 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A1B9Z3 1.86e-45 166 31 6 348 1 hpa/tpa Hypotaurine/taurine--pyruvate aminotransferase Paracoccus denitrificans (strain Pd 1222)
O58478 3.28e-45 165 27 10 414 1 PH0782 Alanine/serine racemase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
M1GRN3 3.55e-45 165 26 8 399 1 None Isoleucine 2-epimerase Lentilactobacillus buchneri
Q5RFA3 3.87e-45 166 28 11 427 2 AGXT2 Alanine--glyoxylate aminotransferase 2, mitochondrial Pongo abelii
Q5W267 4.34e-45 170 34 7 335 1 pigE Aminotransferase PigE Serratia sp. (strain ATCC 39006)
Q9BYV1 5.66e-45 166 28 11 427 1 AGXT2 Alanine--glyoxylate aminotransferase 2, mitochondrial Homo sapiens
A0A0J9X1Q5 6.58e-45 169 34 8 328 1 pigE Aminotransferase PigE Serratia sp. (strain FS14)
Q3UEG6 8.13e-45 165 28 11 412 1 Agxt2 Alanine--glyoxylate aminotransferase 2, mitochondrial Mus musculus
Q2FVJ6 1.52e-44 163 28 12 428 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q84P52 3.01e-44 164 29 12 417 1 GABA-TP3 Gamma aminobutyrate transaminase 3, chloroplastic Solanum lycopersicum
Q5WL78 3.31e-44 162 28 13 406 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Shouchella clausii (strain KSM-K16)
Q94AL9 3.55e-44 162 28 6 392 1 AGT3 Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial Arabidopsis thaliana
E1AQY3 1.43e-43 160 29 10 417 2 VAMT Vanillin aminotransferase Capsicum annuum
D6R3B6 2.98e-43 160 29 10 417 1 PAMT Vanillin aminotransferase Capsicum frutescens
Q84P54 5.21e-43 160 29 11 417 1 GABA-TP1 Gamma aminobutyrate transaminase 1, mitochondrial Solanum lycopersicum
O82521 1.39e-42 158 29 10 417 1 VAMT Vanillin aminotransferase Capsicum chinense
B8BBZ7 1.52e-42 159 28 11 420 3 OsI_28220 Probable gamma-aminobutyrate transaminase 3, mitochondrial Oryza sativa subsp. indica
P16932 2.5e-42 157 28 8 406 1 dgdA 2,2-dialkylglycine decarboxylase Burkholderia cepacia
D5AKY0 2.8e-42 157 27 10 419 2 tpa Taurine--pyruvate aminotransferase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q6ZCF0 3.14e-42 158 28 11 420 3 Os08g0205900 Probable gamma-aminobutyrate transaminase 3, mitochondrial Oryza sativa subsp. japonica
Q9KED4 3.16e-42 156 27 12 405 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9SR86 3.43e-42 157 27 9 390 2 At3g08860 Alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial Arabidopsis thaliana
Q7XN11 6.46e-42 157 30 12 406 1 OSL2 Gamma-aminobutyrate transaminase 1, mitochondrial Oryza sativa subsp. japonica
P56744 7.79e-42 155 28 12 425 1 dat Diaminobutyrate--2-oxoglutarate aminotransferase Acinetobacter baumannii
Q94CE5 8.69e-42 157 29 15 455 1 POP2 Gamma-aminobutyrate transaminase POP2, mitochondrial Arabidopsis thaliana
Q9A3Q9 8.85e-42 155 29 9 394 1 aptA Omega-aminotransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
O53379 1.44e-41 155 29 9 416 1 Rv3329 Probable aminotransferase Rv3329 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q64565 1.73e-41 156 26 11 436 1 Agxt2 Alanine--glyoxylate aminotransferase 2, mitochondrial Rattus norvegicus
Q10174 2.22e-41 155 30 11 406 3 SPAC27F1.05c Uncharacterized aminotransferase C27F1.05c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q829L4 2.4e-41 154 30 13 400 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q7W979 2.55e-41 154 28 13 402 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WHI8 2.55e-41 154 28 13 402 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q6ZH29 2.6e-41 155 28 9 406 2 GABA-T Probable gamma-aminobutyrate transaminase 4 Oryza sativa subsp. japonica
Q01K11 3.09e-41 155 30 12 406 3 OsI_17385 Gamma-aminobutyrate transaminase 1, mitochondrial Oryza sativa subsp. indica
Q84P53 6.22e-41 154 27 8 416 1 GABA-TP2 Gamma aminobutyrate transaminase 2 Solanum lycopersicum
Q8ESU8 9.01e-41 152 28 14 402 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P9WQ79 1.3e-40 152 29 11 426 1 gabT 4-aminobutyrate aminotransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ78 1.3e-40 152 29 11 426 3 gabT 4-aminobutyrate aminotransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63505 1.3e-40 152 29 11 426 3 gabT 4-aminobutyrate aminotransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B1YJU8 3.25e-40 151 35 11 309 3 hemL2 Glutamate-1-semialdehyde 2,1-aminomutase 2 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q2JS70 6e-40 150 34 10 298 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Synechococcus sp. (strain JA-3-3Ab)
Q5YW77 6.65e-40 150 30 12 391 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Nocardia farcinica (strain IFM 10152)
Q5KWK9 9.4e-40 150 30 9 342 3 hemL2 Glutamate-1-semialdehyde 2,1-aminomutase 2 Geobacillus kaustophilus (strain HTA426)
C0ZAH4 9.69e-40 150 33 8 308 3 hemL2 Glutamate-1-semialdehyde 2,1-aminomutase 2 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q2JMP7 2.23e-39 149 33 10 298 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Synechococcus sp. (strain JA-2-3B'a(2-13))
B7GHM5 3.75e-39 149 30 11 393 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
O66557 4.09e-39 149 28 10 363 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Aquifex aeolicus (strain VF5)
A0LIP3 5.14e-39 148 34 9 304 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
C4L4J9 5.57e-39 148 33 8 304 3 hemL2 Glutamate-1-semialdehyde 2,1-aminomutase 2 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A1WYL3 8.14e-39 147 31 9 313 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Halorhodospira halophila (strain DSM 244 / SL1)
Q940M2 8.79e-39 148 26 9 392 1 AGT2 Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial Arabidopsis thaliana
P22805 9.95e-39 147 28 12 415 1 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Lysinibacillus sphaericus
P55628 1.08e-38 147 30 12 400 3 NGR_a01910 Uncharacterized aminotransferase y4qG Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B7K2I1 1.39e-38 147 33 9 316 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Rippkaea orientalis (strain PCC 8801 / RF-1)
P46395 1.7e-38 146 33 9 289 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P31893 3.11e-38 145 33 3 248 2 None Ornithine aminotransferase Vigna aconitifolia
P53555 3.13e-38 146 31 9 357 1 bioK L-Lysine--8-amino-7-oxononanoate transaminase Bacillus subtilis (strain 168)
P12677 4.23e-38 145 34 11 315 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A4IRG2 5.08e-38 145 32 8 294 3 hemL2 Glutamate-1-semialdehyde 2,1-aminomutase 2 Geobacillus thermodenitrificans (strain NG80-2)
B8FBA1 5.15e-38 145 32 11 325 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Desulfatibacillum aliphaticivorans
Q58696 7.56e-38 145 26 9 366 1 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q93RW1 8.8e-38 144 28 12 406 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A5N5Y1 9.48e-38 144 35 10 290 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DZG0 9.48e-38 144 35 10 290 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Clostridium kluyveri (strain NBRC 12016)
A4J6H0 1.1e-37 144 32 8 308 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B2A1H4 1.23e-37 144 30 8 329 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q9I6J2 1.3e-37 144 27 15 414 1 spuC Putrescine--pyruvate aminotransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q6QUY9 1.78e-37 143 29 13 402 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Streptomyces anulatus
B0TFV0 1.87e-37 144 31 7 308 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q9KLC2 2.12e-37 143 29 14 409 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9Z3R2 2.34e-37 144 28 12 412 3 rhbA Diaminobutyrate--2-oxoglutarate aminotransferase Rhizobium meliloti (strain 1021)
Q9ZEU7 3.35e-37 142 29 15 400 1 ectB Diaminobutyrate--2-oxoglutarate transaminase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
P45488 4.22e-37 142 37 9 268 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Mycobacterium leprae (strain TN)
Q0AAH7 4.33e-37 142 31 7 328 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q3ALU9 4.76e-37 142 33 11 332 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Synechococcus sp. (strain CC9605)
O06060 4.92e-37 142 25 11 398 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Marinococcus halophilus
A4XK09 6.1e-37 142 31 6 285 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A1V9X6 6.3e-37 142 32 10 328 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Nitratidesulfovibrio vulgaris (strain DP4)
Q725I1 7.65e-37 142 32 10 328 1 hemL Glutamate-1-semialdehyde 2,1-aminomutase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P53656 7.65e-37 142 34 11 313 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Pseudescherichia vulneris
C0QQ98 7.84e-37 142 31 11 339 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Persephonella marina (strain DSM 14350 / EX-H1)
Q87NZ7 9.54e-37 141 27 12 389 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6AQ32 1.1e-36 141 30 9 322 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q9US34 1.14e-36 142 26 11 417 3 SPAC1039.07c Uncharacterized aminotransferase C1039.07c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B8HYK1 1.38e-36 141 34 9 290 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q8YS26 1.57e-36 141 32 10 313 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
C1DUY4 1.74e-36 141 31 13 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Sulfurihydrogenibium azorense (strain Az-Fu1 / DSM 15241 / OCM 825)
P24630 1.79e-36 141 32 9 317 1 hemL Glutamate-1-semialdehyde 2,1-aminomutase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q2FTK5 1.8e-36 140 35 10 300 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q3AWP4 1.8e-36 141 34 10 304 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Synechococcus sp. (strain CC9902)
A5GMT2 1.84e-36 141 33 10 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Synechococcus sp. (strain WH7803)
P9WQ81 1.91e-36 141 37 8 267 1 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ80 1.91e-36 141 37 8 267 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4X7 1.91e-36 141 37 8 267 1 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B1X023 2.19e-36 140 32 10 308 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q728P4 2.24e-36 142 29 12 403 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q30WH2 2.42e-36 140 34 10 296 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q6PR32 2.6e-36 140 27 13 396 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Virgibacillus pantothenticus
Q8TBG4 3e-36 141 28 17 420 1 ETNPPL Ethanolamine-phosphate phospho-lyase Homo sapiens
Q3M3B9 3.2e-36 140 32 10 313 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q6L2G9 3.28e-36 140 30 11 330 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q7U598 3.87e-36 140 33 10 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Parasynechococcus marenigrum (strain WH8102)
A5GUJ2 4.1e-36 140 32 10 310 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Synechococcus sp. (strain RCC307)
A1KB59 4.13e-36 140 31 9 310 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Azoarcus sp. (strain BH72)
Q9FCC2 4.15e-36 140 35 9 278 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q31QJ2 5.04e-36 140 32 9 317 1 hemL Glutamate-1-semialdehyde 2,1-aminomutase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
E1V7V7 7.5e-36 140 26 9 417 3 doeD Diaminobutyrate--2-oxoglutarate transaminase Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)
Q9AP34 8.51e-36 139 26 11 388 2 ectB Diaminobutyrate--2-oxoglutarate transaminase Sporosarcina pasteurii
B2J7M9 9.02e-36 139 32 9 313 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A4SJ79 1.05e-35 139 31 10 313 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Aeromonas salmonicida (strain A449)
Q8A7T2 1.25e-35 142 32 10 315 3 bioB Biotin biosynthesis bifunctional protein BioAB Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q24VD4 1.35e-35 138 31 11 339 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Desulfitobacterium hafniense (strain Y51)
Q7W3U1 1.37e-35 138 34 12 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
B3QSA6 1.37e-35 139 33 10 293 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
E1WTS4 1.37e-35 142 31 10 313 3 bioB Biotin biosynthesis bifunctional protein BioAB Bacteroides fragilis (strain 638R)
Q7WF71 1.47e-35 138 34 12 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P91408 1.62e-35 139 27 14 428 3 eppl-1 Ethanolamine-phosphate phospho-lyase homolog 1 Caenorhabditis elegans
B7KA18 1.73e-35 138 30 10 345 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Gloeothece citriformis (strain PCC 7424)
B8G2L6 1.79e-35 138 32 10 316 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
C4LAK4 2.08e-35 138 31 10 314 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
P44426 2.09e-35 138 29 13 407 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A7NKV1 2.18e-35 138 34 9 294 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q3A7W5 2.69e-35 137 29 9 317 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B9MRJ7 2.73e-35 137 31 9 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
B5EFG4 2.98e-35 137 29 9 307 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q2Y5Q5 3.39e-35 137 30 8 307 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q7SY54 4.09e-35 138 26 14 420 2 etnppl Ethanolamine-phosphate phospho-lyase Danio rerio
Q1QSB0 4.17e-35 137 30 10 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A5D3M2 4.75e-35 137 30 8 318 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A6VQ66 4.8e-35 137 32 12 321 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q7W050 5.42e-35 137 34 12 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B1XIT5 6.24e-35 137 32 10 313 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q5LEY1 6.42e-35 140 31 10 313 3 bioB Biotin biosynthesis bifunctional protein BioAB Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A1RMG7 6.55e-35 137 30 11 313 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella sp. (strain W3-18-1)
A4Y4G4 6.55e-35 137 30 11 313 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
O66998 6.72e-35 136 30 7 313 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Aquifex aeolicus (strain VF5)
B0TIQ0 6.78e-35 136 29 11 319 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella halifaxensis (strain HAW-EB4)
Q1GXW0 8.77e-35 136 32 12 314 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q64VX4 8.95e-35 139 31 10 313 3 bioB Biotin biosynthesis bifunctional protein BioAB Bacteroides fragilis (strain YCH46)
B0CC57 9.06e-35 136 32 11 297 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Acaryochloris marina (strain MBIC 11017)
B8CJG4 9.09e-35 136 29 11 319 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella piezotolerans (strain WP3 / JCM 13877)
B3E9X0 1.13e-34 136 30 9 308 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q01YQ2 1.16e-34 135 33 10 291 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Solibacter usitatus (strain Ellin6076)
A0A098DDI1 1.18e-34 137 29 11 402 3 FGRAMPH1_01T09365 Aminotransferase FGSG_17085 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A8H164 1.26e-34 136 29 12 320 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q9VU95 1.42e-34 137 26 14 409 2 CG8745 Alanine--glyoxylate aminotransferase 2-like Drosophila melanogaster
Q55665 1.45e-34 135 31 8 307 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8BWU8 1.48e-34 137 28 15 411 2 Etnppl Ethanolamine-phosphate phospho-lyase Mus musculus
Q67KM3 1.57e-34 135 30 7 308 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q5QVP9 1.84e-34 135 30 9 310 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A5UU40 1.86e-34 135 33 10 308 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Roseiflexus sp. (strain RS-1)
Q0I8G1 1.94e-34 135 33 9 292 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Synechococcus sp. (strain CC9311)
Q2S1S3 2.1e-34 135 31 10 310 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salinibacter ruber (strain DSM 13855 / M31)
Q8DLK8 2.58e-34 135 32 9 290 1 hemL Glutamate-1-semialdehyde 2,1-aminomutase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A2C0U2 2.64e-34 135 32 9 290 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Prochlorococcus marinus (strain NATL1A)
B7GH35 2.85e-34 135 28 8 329 3 hemL2 Glutamate-1-semialdehyde 2,1-aminomutase 2 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A1S3U0 2.99e-34 135 30 12 314 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q0AFV1 3.05e-34 135 30 8 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q46GT9 3.65e-34 134 32 9 290 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Prochlorococcus marinus (strain NATL2A)
Q3IHS1 4.11e-34 134 28 8 312 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Pseudoalteromonas translucida (strain TAC 125)
A5IC29 4.26e-34 134 32 9 321 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Legionella pneumophila (strain Corby)
A9BEA5 4.99e-34 134 31 9 308 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Prochlorococcus marinus (strain MIT 9211)
Q2KUS4 5.11e-34 134 33 11 308 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Bordetella avium (strain 197N)
Q3SFU6 5.82e-34 134 31 11 314 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Thiobacillus denitrificans (strain ATCC 25259)
Q2IHP8 5.98e-34 134 31 9 292 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q3ACS9 6.29e-34 134 29 7 309 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
C0QCR9 6.48e-34 134 30 10 315 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
A8FS76 6.81e-34 134 29 11 332 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella sediminis (strain HAW-EB3)
Q8R1K4 6.82e-34 134 27 20 427 1 Phykpl 5-phosphohydroxy-L-lysine phospho-lyase Mus musculus
Q31SA6 6.94e-34 134 31 8 322 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q7M181 7.25e-34 134 29 10 403 1 None 2-aminohexano-6-lactam racemase Achromobacter obae
A3D1R5 7.77e-34 134 29 12 314 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A3DIF3 7.88e-34 134 29 9 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q5X529 8.5e-34 134 31 9 321 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Legionella pneumophila (strain Paris)
Q110Z9 9.23e-34 134 30 10 318 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Trichodesmium erythraeum (strain IMS101)
P42799 9.8e-34 134 34 11 287 1 GSA1 Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic Arabidopsis thaliana
A6WKL6 1.06e-33 133 29 12 314 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella baltica (strain OS185)
B8EBU3 1.06e-33 133 29 12 314 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella baltica (strain OS223)
A9I1R3 1.07e-33 133 32 11 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q5ZVA6 1.1e-33 133 31 9 321 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q12KC8 1.12e-33 133 31 11 313 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A0B885 1.29e-33 133 29 9 315 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
A9L5J5 1.31e-33 133 29 11 313 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella baltica (strain OS195)
Q9ZKM5 1.33e-33 133 27 13 411 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Helicobacter pylori (strain J99 / ATCC 700824)
Q7V2J3 1.33e-33 133 32 9 290 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
B2VE25 1.42e-33 133 30 10 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B8JCU6 1.44e-33 133 30 9 292 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A2C7I7 1.48e-33 133 32 9 290 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Prochlorococcus marinus (strain MIT 9303)
Q48DP1 1.49e-33 133 29 12 347 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A6VIL1 1.53e-33 133 31 9 300 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
O25627 1.56e-33 133 27 12 409 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Helicobacter pylori (strain ATCC 700392 / 26695)
A5G9C0 1.58e-33 133 29 9 307 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Geotalea uraniireducens (strain Rf4)
Q5WWG1 1.6e-33 133 31 9 316 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Legionella pneumophila (strain Lens)
Q82E21 1.7e-33 133 32 9 293 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q58020 1.87e-33 132 30 8 300 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8RFY7 1.88e-33 132 27 9 329 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q39QA6 1.97e-33 132 29 9 307 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B4UKE6 2.02e-33 132 30 9 292 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Anaeromyxobacter sp. (strain K)
Q6M0P5 2.07e-33 132 30 9 301 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
A1BJG8 2.07e-33 132 30 11 334 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B4S3Q6 2.12e-33 132 31 10 302 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
C3K2K3 2.27e-33 132 31 9 309 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Pseudomonas fluorescens (strain SBW25)
B1I4L1 2.33e-33 132 30 7 308 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Desulforudis audaxviator (strain MP104C)
Q5E9S4 2.36e-33 133 27 17 427 2 ETNPPL Ethanolamine-phosphate phospho-lyase Bos taurus
Q3K6C0 2.98e-33 132 31 10 309 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Pseudomonas fluorescens (strain Pf0-1)
Q85WB7 3.02e-33 133 32 11 297 2 GSA Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic Brassica napus
A4XYV6 3.1e-33 132 30 8 308 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Pseudomonas mendocina (strain ymp)
Q4ZNA0 3.61e-33 132 30 9 309 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Pseudomonas syringae pv. syringae (strain B728a)
A3PBK8 3.95e-33 132 31 10 314 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Prochlorococcus marinus (strain MIT 9301)
Q74GA9 3.95e-33 132 29 9 304 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q7V677 4.48e-33 131 32 9 290 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Prochlorococcus marinus (strain MIT 9313)
Q6HD65 4.59e-33 131 33 11 286 3 hemL2 Glutamate-1-semialdehyde 2,1-aminomutase 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
B7JQ54 4.59e-33 131 33 11 286 3 hemL2 Glutamate-1-semialdehyde 2,1-aminomutase 2 Bacillus cereus (strain AH820)
Q633Y3 4.69e-33 131 33 11 286 3 hemL2 Glutamate-1-semialdehyde 2,1-aminomutase 2 Bacillus cereus (strain ZK / E33L)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_11850
Feature type CDS
Gene astC
Product Acetylornithine/succinyldiaminopimelate/putrescin e aminotransferase
Location 20252 - 21472 (strand: -1)
Length 1221 (nucleotides) / 406 (amino acids)

Contig

Accession contig_14
Length 134564 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1699
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00202 Aminotransferase class-III

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4992 Amino acid transport and metabolism (E) E Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase

Kegg Ortholog Annotation(s)

Protein Sequence

MTKQNAVTRGTYDEVMLPIYAPADFIPVRGQGSRVWDQNGTEYVDFAGGIAVLALGHCHPALIAALKAQSESLWHVSNIFTNEPALILAQKLIKHTFAERVFFANSGAEANEAAFKLARHYALTRHHPYKTKIIAFHHGFHGRTLFTVSVGGQPKYADGFGPKPADIIHVPFNDLDAVKAVMDDHTCAVVLEPVQGEGGITPATPAFMQGLRELCDKHQALLVFDEVQSGMGRSGKLFAYMDYGIEPDILTTAKALGGGFPISAMLTKQDIAQVMVPGTHGTTYGGNPLACAVGNAAFDLINDPALLAGVNERHQWFADALQSLNSTFGAFAEIRGKGLLIGAELAGIYRDQSKTLLGLAAKNGLMLLNAGTNVLRFTPSLIIEKADVDEGMKRLAKTLSDFREMQ

Flanking regions ( +/- flanking 50bp)

TCATATTTGGTGATTATATTTTCACTTGTGGATAGATCAGGTAAGGAACGATGACAAAACAGAATGCGGTTACGCGCGGCACTTATGATGAAGTGATGCTGCCAATTTATGCACCGGCTGATTTTATTCCTGTCAGAGGTCAGGGAAGCCGGGTGTGGGATCAGAACGGCACTGAATATGTTGATTTCGCCGGTGGTATTGCCGTACTGGCGCTGGGCCATTGTCATCCGGCACTGATCGCGGCCCTGAAAGCCCAGAGTGAATCGCTCTGGCATGTCAGCAATATTTTTACTAATGAACCGGCGCTGATACTGGCGCAGAAGCTGATAAAACATACGTTTGCGGAACGGGTTTTCTTTGCCAACTCCGGTGCGGAGGCAAATGAAGCCGCATTCAAACTGGCGCGTCATTATGCACTGACCCGTCATCATCCTTATAAAACCAAAATTATCGCTTTCCATCACGGCTTCCACGGCCGGACACTCTTTACCGTTTCTGTCGGTGGTCAGCCGAAATATGCTGATGGCTTCGGGCCGAAACCGGCAGATATTATTCATGTGCCTTTTAACGACCTTGATGCTGTCAAAGCAGTGATGGATGATCACACCTGTGCCGTGGTGCTGGAACCTGTCCAGGGCGAGGGCGGGATCACACCTGCCACACCGGCCTTTATGCAGGGCCTGCGTGAATTATGTGATAAACATCAGGCGCTGCTGGTATTTGATGAAGTGCAGAGCGGGATGGGGCGCAGCGGCAAACTGTTTGCCTATATGGATTACGGCATTGAGCCGGATATTCTGACCACGGCCAAAGCGCTGGGCGGCGGTTTCCCGATCAGTGCCATGCTGACAAAACAGGACATTGCACAGGTGATGGTACCCGGTACGCACGGTACAACCTACGGCGGCAACCCGCTGGCCTGTGCGGTCGGTAATGCGGCCTTTGATCTGATCAACGACCCGGCATTGCTGGCGGGAGTGAATGAGCGCCACCAGTGGTTTGCGGATGCACTGCAATCCCTGAACAGTACATTTGGTGCATTTGCGGAGATCCGCGGGAAAGGGCTGCTGATTGGTGCCGAACTGGCGGGTATCTACCGCGATCAGTCAAAAACCCTGCTGGGACTGGCAGCCAAAAACGGTCTGATGCTGCTTAACGCCGGTACCAATGTTCTGCGTTTCACGCCATCGCTGATTATTGAAAAAGCCGATGTGGATGAAGGGATGAAACGACTGGCAAAAACCCTGAGTGATTTTCGGGAAATGCAGTAAACGGCGGGATTCAGAAACAAAAAAACAGGCGCAGATGCGCCTGTTTTGGT