Homologs in group_1596

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_14745 EHELCC_14745 100.0 Morganella morganii S2 aroK shikimate kinase AroK
NLDBIP_14575 NLDBIP_14575 100.0 Morganella morganii S4 aroK shikimate kinase AroK
LHKJJB_14770 LHKJJB_14770 100.0 Morganella morganii S3 aroK shikimate kinase AroK
HKOGLL_13390 HKOGLL_13390 100.0 Morganella morganii S5 aroK shikimate kinase AroK
F4V73_RS14105 F4V73_RS14105 98.3 Morganella psychrotolerans aroK shikimate kinase AroK
PMI_RS14970 PMI_RS14970 93.1 Proteus mirabilis HI4320 aroK shikimate kinase AroK

Distribution of the homologs in the orthogroup group_1596

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1596

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1JIQ3 1.23e-113 322 92 0 173 3 aroK Shikimate kinase 1 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664L9 1.23e-113 322 92 0 173 3 aroK Shikimate kinase 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGU1 1.23e-113 322 92 0 173 3 aroK Shikimate kinase 1 Yersinia pestis (strain Pestoides F)
Q1CCN9 1.23e-113 322 92 0 173 3 aroK Shikimate kinase 1 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4B0 1.23e-113 322 92 0 173 3 aroK Shikimate kinase 1 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJF7 1.23e-113 322 92 0 173 3 aroK Shikimate kinase 1 Yersinia pestis
B2K5T5 1.23e-113 322 92 0 173 3 aroK Shikimate kinase 1 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2P2 1.23e-113 322 92 0 173 3 aroK Shikimate kinase 1 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNT6 1.23e-113 322 92 0 173 3 aroK Shikimate kinase 1 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JSD4 6.12e-113 321 91 0 173 3 aroK Shikimate kinase 1 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GKQ8 6.12e-113 321 91 0 173 3 aroK Shikimate kinase 1 Serratia proteamaculans (strain 568)
B2VJW8 7.8e-112 318 92 0 171 3 aroK Shikimate kinase 1 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6CZQ8 2.26e-111 317 90 0 173 3 aroK Shikimate kinase 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P63601 3.08e-111 317 89 0 173 3 aroK Shikimate kinase 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63602 3.08e-111 317 89 0 173 3 aroK Shikimate kinase 1 Salmonella typhi
B4TY47 3.08e-111 317 89 0 173 3 aroK Shikimate kinase 1 Salmonella schwarzengrund (strain CVM19633)
B5BH30 3.08e-111 317 89 0 173 3 aroK Shikimate kinase 1 Salmonella paratyphi A (strain AKU_12601)
Q5PLX1 3.08e-111 317 89 0 173 3 aroK Shikimate kinase 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SVI9 3.08e-111 317 89 0 173 3 aroK Shikimate kinase 1 Salmonella newport (strain SL254)
B4TKR3 3.08e-111 317 89 0 173 3 aroK Shikimate kinase 1 Salmonella heidelberg (strain SL476)
B5R7M7 3.08e-111 317 89 0 173 3 aroK Shikimate kinase 1 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2D6 3.08e-111 317 89 0 173 3 aroK Shikimate kinase 1 Salmonella enteritidis PT4 (strain P125109)
B5FJR0 3.08e-111 317 89 0 173 3 aroK Shikimate kinase 1 Salmonella dublin (strain CT_02021853)
Q57IY7 3.08e-111 317 89 0 173 3 aroK Shikimate kinase 1 Salmonella choleraesuis (strain SC-B67)
B5F8K1 3.08e-111 317 89 0 173 3 aroK Shikimate kinase 1 Salmonella agona (strain SL483)
A8AQU4 3.79e-111 316 89 0 173 3 aroK Shikimate kinase 1 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7LS91 1.13e-110 315 89 0 173 3 aroK Shikimate kinase 1 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4WFH8 1.23e-110 315 89 0 173 3 aroK Shikimate kinase 1 Enterobacter sp. (strain 638)
Q3YWN3 1.32e-110 315 89 0 173 3 aroK Shikimate kinase 1 Shigella sonnei (strain Ss046)
P0A6E0 1.32e-110 315 89 0 173 3 aroK Shikimate kinase 1 Shigella flexneri
Q32AK2 1.32e-110 315 89 0 173 3 aroK Shikimate kinase 1 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VP4 1.32e-110 315 89 0 173 3 aroK Shikimate kinase 1 Shigella boydii serotype 4 (strain Sb227)
B2U3J6 1.32e-110 315 89 0 173 3 aroK Shikimate kinase 1 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7NDZ4 1.32e-110 315 89 0 173 3 aroK Shikimate kinase 1 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6D7 1.32e-110 315 89 0 173 1 aroK Shikimate kinase 1 Escherichia coli (strain K12)
B1IP75 1.32e-110 315 89 0 173 3 aroK Shikimate kinase 1 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6D8 1.32e-110 315 89 0 173 3 aroK Shikimate kinase 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A5J7 1.32e-110 315 89 0 173 3 aroK Shikimate kinase 1 Escherichia coli O9:H4 (strain HS)
B1X737 1.32e-110 315 89 0 173 3 aroK Shikimate kinase 1 Escherichia coli (strain K12 / DH10B)
B7M1U2 1.32e-110 315 89 0 173 3 aroK Shikimate kinase 1 Escherichia coli O8 (strain IAI1)
B7NMF3 1.32e-110 315 89 0 173 3 aroK Shikimate kinase 1 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0A6D9 1.32e-110 315 89 0 173 3 aroK Shikimate kinase 1 Escherichia coli O157:H7
B7MD01 1.32e-110 315 89 0 173 3 aroK Shikimate kinase 1 Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZSR5 1.32e-110 315 89 0 173 3 aroK Shikimate kinase 1 Escherichia coli O139:H28 (strain E24377A / ETEC)
Q2NQJ1 5.88e-110 313 89 0 173 3 aroK Shikimate kinase 1 Sodalis glossinidius (strain morsitans)
Q7NA55 3.81e-104 298 91 0 173 3 aroK Shikimate kinase 1 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1LU61 9.69e-102 292 82 0 173 3 aroK Shikimate kinase Baumannia cicadellinicola subsp. Homalodisca coagulata
A0KN29 5.97e-101 290 80 0 170 3 aroK Shikimate kinase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SK24 8.39e-101 290 79 0 170 3 aroK Shikimate kinase Aeromonas salmonicida (strain A449)
Q9KNV1 8.9e-98 283 81 1 171 3 aroK Shikimate kinase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F523 8.9e-98 283 81 1 171 3 aroK Shikimate kinase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MH83 2.13e-97 281 81 1 171 3 aroK Shikimate kinase Vibrio vulnificus (strain YJ016)
Q8DCM1 2.13e-97 281 81 1 171 3 aroK Shikimate kinase Vibrio vulnificus (strain CMCP6)
Q6LVF6 2.76e-97 281 81 1 171 3 aroK Shikimate kinase Photobacterium profundum (strain SS9)
B6EM43 5.07e-97 280 80 1 171 3 aroK Shikimate kinase Aliivibrio salmonicida (strain LFI1238)
Q87L67 1e-96 280 80 1 171 3 aroK Shikimate kinase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B5FBN2 2.16e-96 279 80 1 171 3 aroK Shikimate kinase Aliivibrio fischeri (strain MJ11)
Q5E2F9 2.16e-96 279 80 1 171 3 aroK Shikimate kinase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A7MSY3 3.57e-96 278 80 1 171 3 aroK Shikimate kinase Vibrio campbellii (strain ATCC BAA-1116)
P57605 1.19e-95 277 80 0 171 3 aroK Shikimate kinase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A8GZ29 2.96e-94 273 77 1 170 3 aroK Shikimate kinase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q8EK20 3.64e-94 273 78 1 170 3 aroK Shikimate kinase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A0L243 4.79e-94 273 78 1 170 3 aroK Shikimate kinase Shewanella sp. (strain ANA-3)
Q0I053 5.12e-94 273 78 1 170 3 aroK Shikimate kinase Shewanella sp. (strain MR-7)
Q0HDV6 5.12e-94 273 78 1 170 3 aroK Shikimate kinase Shewanella sp. (strain MR-4)
A1SB14 6.8e-94 273 78 1 170 3 aroK Shikimate kinase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A1RPQ7 9.35e-94 272 77 1 170 3 aroK Shikimate kinase Shewanella sp. (strain W3-18-1)
A4YBT1 9.35e-94 272 77 1 170 3 aroK Shikimate kinase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9L695 9.35e-94 272 77 1 170 3 aroK Shikimate kinase Shewanella baltica (strain OS195)
A6WTR2 9.35e-94 272 77 1 170 3 aroK Shikimate kinase Shewanella baltica (strain OS185)
A3DA15 9.35e-94 272 77 1 170 3 aroK Shikimate kinase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A8G196 1.85e-93 271 77 1 170 3 aroK Shikimate kinase Shewanella sediminis (strain HAW-EB3)
B1KP71 2.32e-93 271 77 1 170 3 aroK Shikimate kinase Shewanella woodyi (strain ATCC 51908 / MS32)
B0TL77 2.48e-93 271 77 1 170 3 aroK Shikimate kinase Shewanella halifaxensis (strain HAW-EB4)
Q3IJC5 3.98e-93 271 76 0 171 3 aroK Shikimate kinase Pseudoalteromonas translucida (strain TAC 125)
Q8K938 9.17e-93 270 77 0 171 3 aroK Shikimate kinase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q12SL9 1.55e-92 269 76 1 170 3 aroK Shikimate kinase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A3Q9D7 3.3e-92 268 76 1 170 3 aroK Shikimate kinase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q088S7 3.48e-91 266 75 1 170 3 aroK Shikimate kinase Shewanella frigidimarina (strain NCIMB 400)
Q8D1X8 3.85e-91 266 73 0 170 3 aroK Shikimate kinase Wigglesworthia glossinidia brevipalpis
Q5QV48 5.43e-91 265 75 0 172 3 aroK Shikimate kinase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
C4K6R0 5.59e-91 265 75 0 171 3 aroK Shikimate kinase 1 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
C4LB08 2.15e-90 264 73 0 170 3 aroK Shikimate kinase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q15Y43 4.15e-90 263 73 1 168 3 aroK Shikimate kinase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q65R34 5.07e-90 263 72 0 171 3 aroK Shikimate kinase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q489N4 2.37e-89 261 73 0 171 3 aroK Shikimate kinase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A6VKZ6 2.02e-88 259 73 0 171 3 aroK Shikimate kinase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q4QNY3 2.47e-88 259 72 0 172 3 aroK Shikimate kinase Haemophilus influenzae (strain 86-028NP)
B4S0F6 2.82e-88 258 72 1 167 3 aroK Shikimate kinase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
P43880 3.5e-88 258 72 0 172 3 aroK Shikimate kinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UG09 3.5e-88 258 72 0 172 3 aroK Shikimate kinase Haemophilus influenzae (strain PittGG)
P57925 3.85e-88 258 72 0 171 3 aroK Shikimate kinase Pasteurella multocida (strain Pm70)
A5UAU9 4e-88 258 72 0 171 3 aroK Shikimate kinase Haemophilus influenzae (strain PittEE)
B0UTE7 1.88e-87 256 72 0 171 3 aroK Shikimate kinase Histophilus somni (strain 2336)
B0BSJ7 1.88e-86 254 71 1 171 3 aroK Shikimate kinase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3MYR6 1.88e-86 254 71 1 171 3 aroK Shikimate kinase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VNR4 2.05e-86 254 71 2 172 3 aroK Shikimate kinase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q492A4 7.05e-84 248 71 1 177 3 aroK Shikimate kinase Blochmanniella pennsylvanica (strain BPEN)
P59488 1.44e-82 244 67 1 171 3 aroK Shikimate kinase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1SRB6 1.2e-81 241 67 1 171 3 aroK Shikimate kinase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q7VRN2 4.61e-78 233 62 1 178 3 aroK Shikimate kinase Blochmanniella floridana
Q5WXX6 7.54e-68 207 59 1 166 3 aroK Shikimate kinase Legionella pneumophila (strain Lens)
Q5ZX01 7.54e-68 207 59 1 166 3 aroK Shikimate kinase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IFY0 7.54e-68 207 59 1 166 3 aroK Shikimate kinase Legionella pneumophila (strain Corby)
Q5X6H1 7.54e-68 207 59 1 166 3 aroK Shikimate kinase Legionella pneumophila (strain Paris)
Q0BMF5 1.42e-63 196 56 2 171 3 aroK Shikimate kinase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A419 1.42e-63 196 56 2 171 3 aroK Shikimate kinase Francisella tularensis subsp. holarctica (strain LVS)
A7NBG9 1.42e-63 196 56 2 171 3 aroK Shikimate kinase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A4IYJ0 3.36e-63 195 56 2 171 3 aroK Shikimate kinase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NFS0 3.36e-63 195 56 2 171 3 aroK Shikimate kinase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q707 3.36e-63 195 56 2 171 3 aroK Shikimate kinase Francisella tularensis subsp. novicida (strain U112)
B2SGC8 3.36e-63 195 56 2 171 3 aroK Shikimate kinase Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14H72 3.36e-63 195 56 2 171 3 aroK Shikimate kinase Francisella tularensis subsp. tularensis (strain FSC 198)
B0TXQ6 2.74e-62 193 55 2 171 3 aroK Shikimate kinase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A1WZB0 1.85e-59 186 53 2 174 3 aroK Shikimate kinase Halorhodospira halophila (strain DSM 244 / SL1)
Q60BY3 6.26e-59 184 52 1 173 3 aroK Shikimate kinase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q87V14 1.37e-58 183 55 1 166 3 aroK Shikimate kinase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B0V8M8 2.01e-58 183 52 1 168 3 aroK Shikimate kinase Acinetobacter baumannii (strain AYE)
B0VQ33 2.01e-58 183 52 1 168 3 aroK Shikimate kinase Acinetobacter baumannii (strain SDF)
Q48PH1 3.62e-58 182 55 1 166 3 aroK Shikimate kinase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZZE4 5.2e-58 182 55 1 166 3 aroK Shikimate kinase Pseudomonas syringae pv. syringae (strain B728a)
A6VDG0 6.14e-57 179 52 1 165 3 aroK Shikimate kinase Pseudomonas aeruginosa (strain PA7)
Q31DP8 5.38e-56 177 51 1 168 3 aroK Shikimate kinase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P34003 1.66e-55 176 52 1 165 3 aroK Shikimate kinase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02EX8 1.66e-55 176 52 1 165 3 aroK Shikimate kinase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3D2 1.66e-55 176 52 1 165 3 aroK Shikimate kinase Pseudomonas aeruginosa (strain LESB58)
Q4KJI9 1.93e-55 175 52 1 167 3 aroK Shikimate kinase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B8GPV2 4.61e-55 175 51 1 174 3 aroK Shikimate kinase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q1QZY3 6.94e-55 174 53 1 162 3 aroK Shikimate kinase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q2S9Q5 1.12e-54 174 48 1 170 3 aroK Shikimate kinase Hahella chejuensis (strain KCTC 2396)
Q6F7E4 1.13e-54 174 52 2 167 3 aroK Shikimate kinase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q4FQI2 1.29e-54 174 49 1 170 3 aroK Shikimate kinase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1Q8Q8 1.59e-54 173 50 1 170 3 aroK Shikimate kinase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q1IGA8 2.16e-54 172 52 1 167 3 aroK Shikimate kinase Pseudomonas entomophila (strain L48)
Q88CV1 6.37e-53 169 50 1 167 3 aroK Shikimate kinase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WAB2 6.37e-53 169 50 1 167 3 aroK Shikimate kinase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q3KJA2 1.17e-52 168 51 1 166 3 aroK Shikimate kinase Pseudomonas fluorescens (strain Pf0-1)
Q3JEG4 3.38e-52 167 52 1 165 3 aroK Shikimate kinase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A5WCG4 3.6e-52 167 47 1 168 3 aroK Shikimate kinase Psychrobacter sp. (strain PRwf-1)
Q7NZU3 3.2e-51 165 50 1 165 3 aroK Shikimate kinase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q3SM89 1.22e-48 158 49 1 158 3 aroK Shikimate kinase Thiobacillus denitrificans (strain ATCC 25259)
Q39KC5 9.53e-48 156 48 1 166 3 aroK Shikimate kinase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q2SU71 1.17e-47 156 48 1 166 3 aroK Shikimate kinase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q56 1.44e-47 155 48 1 166 3 aroK Shikimate kinase Burkholderia pseudomallei (strain K96243)
Q3JMW0 1.44e-47 155 48 1 166 3 aroK Shikimate kinase Burkholderia pseudomallei (strain 1710b)
Q62GA9 1.44e-47 155 48 1 166 3 aroK Shikimate kinase Burkholderia mallei (strain ATCC 23344)
Q46WJ3 1.37e-46 153 47 1 168 3 aroK Shikimate kinase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8XV61 2.33e-46 153 46 1 166 3 aroK Shikimate kinase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A6W2T4 1.03e-45 151 43 2 173 3 aroK Shikimate kinase Marinomonas sp. (strain MWYL1)
Q2YBB2 1.32e-45 151 45 1 173 3 aroK Shikimate kinase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q47JK7 3.03e-45 150 47 2 168 3 aroK Shikimate kinase Dechloromonas aromatica (strain RCB)
Q2L1Z2 9.11e-45 149 45 1 166 3 aroK Shikimate kinase Bordetella avium (strain 197N)
B6J4A3 1.42e-44 148 44 2 164 3 aroK Shikimate kinase Coxiella burnetii (strain CbuK_Q154)
A9KBB0 1.44e-44 148 44 2 164 3 aroK Shikimate kinase Coxiella burnetii (strain Dugway 5J108-111)
Q7VT94 2.11e-44 149 45 1 166 3 aroK Shikimate kinase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2B7 2.11e-44 149 45 1 166 3 aroK Shikimate kinase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WR85 3.02e-44 148 45 1 166 3 aroK Shikimate kinase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q5P5P2 5.19e-44 146 50 1 146 3 aroK Shikimate kinase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q83AJ3 5.38e-43 144 43 2 164 1 aroK Shikimate kinase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
B6J3I0 5.38e-43 144 43 2 164 3 aroK Shikimate kinase Coxiella burnetii (strain CbuG_Q212)
A9NB80 5.75e-43 144 43 2 164 3 aroK Shikimate kinase Coxiella burnetii (strain RSA 331 / Henzerling II)
B0U6C8 8.98e-41 138 38 1 167 3 aroK Shikimate kinase Xylella fastidiosa (strain M12)
B2FQI7 1.14e-40 138 42 2 173 3 aroK Shikimate kinase Stenotrophomonas maltophilia (strain K279a)
Q5H3H3 1.48e-40 137 41 2 168 3 aroK Shikimate kinase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SK35 1.48e-40 137 41 2 168 3 aroK Shikimate kinase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P6C8 1.48e-40 137 41 2 168 3 aroK Shikimate kinase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q87DU8 1.56e-40 137 39 2 168 3 aroK Shikimate kinase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9G1 1.56e-40 137 39 2 168 3 aroK Shikimate kinase Xylella fastidiosa (strain M23)
Q3BQS2 1.9e-40 137 41 2 168 3 aroK Shikimate kinase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B4SSA3 2.26e-40 137 42 2 173 3 aroK Shikimate kinase Stenotrophomonas maltophilia (strain R551-3)
Q8PI88 3.57e-40 137 40 1 167 3 aroK Shikimate kinase Xanthomonas axonopodis pv. citri (strain 306)
Q82TC0 4.01e-39 135 41 1 165 3 aroK Shikimate kinase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q9PDP4 7.39e-39 133 38 2 168 3 aroK Shikimate kinase Xylella fastidiosa (strain 9a5c)
Q5FAD3 1.24e-38 132 44 1 150 3 aroK Shikimate kinase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
P63600 1.29e-38 132 44 1 150 3 aroK Putative shikimate kinase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P63599 1.29e-38 132 44 1 150 3 aroK Putative shikimate kinase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M1U5 1.29e-38 132 44 1 150 3 aroK Shikimate kinase Neisseria meningitidis serogroup C (strain 053442)
Q8P6X4 3.2e-38 132 39 2 168 3 aroK Shikimate kinase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UX85 3.2e-38 132 39 2 168 3 aroK Shikimate kinase Xanthomonas campestris pv. campestris (strain 8004)
Q6G1H5 1.24e-33 121 38 2 165 3 aroK Shikimate kinase Bartonella quintana (strain Toulouse)
A1TKW2 2.25e-33 119 46 2 149 3 aroK Shikimate kinase Paracidovorax citrulli (strain AAC00-1)
Q0S0N1 2.29e-33 119 40 3 170 3 aroK Shikimate kinase Rhodococcus jostii (strain RHA1)
Q2W095 2.37e-33 120 41 2 168 3 aroK Shikimate kinase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q3B009 7.23e-33 118 39 4 169 3 aroK Shikimate kinase Synechococcus sp. (strain CC9902)
Q8FY59 1.02e-32 118 38 2 167 3 aroK Shikimate kinase Brucella suis biovar 1 (strain 1330)
B0CJD1 1.02e-32 118 38 2 167 3 aroK Shikimate kinase Brucella suis (strain ATCC 23445 / NCTC 10510)
C0RFS0 1.02e-32 118 38 2 167 3 aroK Shikimate kinase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M9B4 1.02e-32 118 38 2 167 3 aroK Shikimate kinase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57AM8 1.02e-32 118 38 2 167 3 aroK Shikimate kinase Brucella abortus biovar 1 (strain 9-941)
Q2YR42 1.02e-32 118 38 2 167 3 aroK Shikimate kinase Brucella abortus (strain 2308)
B2S8S9 1.02e-32 118 38 2 167 3 aroK Shikimate kinase Brucella abortus (strain S19)
Q7U469 1.04e-32 118 37 4 169 3 aroK Shikimate kinase Parasynechococcus marenigrum (strain WH8102)
Q6NCG8 6.85e-32 116 37 2 167 3 aroK Shikimate kinase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q3AH55 7.58e-32 116 36 4 169 3 aroK Shikimate kinase Synechococcus sp. (strain CC9605)
Q98FY0 1.57e-31 115 38 2 167 3 aroK Shikimate kinase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q6G1N9 3.87e-31 114 34 2 165 3 aroK Shikimate kinase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A2C650 1.64e-30 112 39 4 167 3 aroK Shikimate kinase Prochlorococcus marinus (strain MIT 9303)
Q89XW7 3.15e-30 112 39 2 169 3 aroK Shikimate kinase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9X5D1 3.73e-30 111 40 4 169 3 aroK Shikimate kinase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8FT30 8.21e-30 110 38 3 165 3 aroK Shikimate kinase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P72796 8.5e-30 110 40 4 163 3 aroK Shikimate kinase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q2G733 8.93e-30 110 36 4 173 3 aroK Shikimate kinase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q5LSY0 2.16e-29 109 36 3 172 3 aroK Shikimate kinase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q3SVM9 3.11e-29 110 44 2 167 3 aroK Shikimate kinase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q7V904 3.57e-29 109 38 4 167 3 aroK Shikimate kinase Prochlorococcus marinus (strain MIT 9313)
A4XLN3 4.08e-29 108 35 2 165 3 aroK Shikimate kinase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q46HR4 9.03e-29 108 36 4 169 3 aroK Shikimate kinase Prochlorococcus marinus (strain NATL2A)
B8H331 1e-28 108 37 2 166 3 aroK Shikimate kinase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A435 1e-28 108 37 2 166 3 aroK Shikimate kinase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
C0QR76 1.68e-28 106 36 2 163 3 aroK Shikimate kinase Persephonella marina (strain DSM 14350 / EX-H1)
Q2RMW1 2.55e-28 107 38 2 158 3 aroK Shikimate kinase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q47QY8 2.61e-28 106 37 4 170 3 aroK Shikimate kinase Thermobifida fusca (strain YX)
B9MKD6 3.04e-28 106 34 2 165 3 aroK Shikimate kinase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
B2V895 3.28e-28 105 36 3 163 3 aroK Shikimate kinase Sulfurihydrogenibium sp. (strain YO3AOP1)
O67925 4.53e-28 105 35 4 168 1 aroK Shikimate kinase Aquifex aeolicus (strain VF5)
B5ZSI5 5.17e-28 106 34 2 166 3 aroK Shikimate kinase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q3MFQ9 5.2e-28 105 34 4 168 3 aroK Shikimate kinase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B5YHI3 5.89e-28 105 38 2 164 3 aroK Shikimate kinase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q3J2I9 1.19e-27 105 34 2 169 3 aroK Shikimate kinase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A0LUH0 4.45e-27 103 37 3 164 3 aroK Shikimate kinase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q6NH03 5.36e-27 103 37 3 166 3 aroK Shikimate kinase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q2RI74 6.72e-27 102 40 3 167 3 aroK Shikimate kinase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q5NPY7 7.35e-27 102 38 2 166 3 aroK Shikimate kinase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q8RAE8 9.61e-27 102 36 3 166 3 aroK Shikimate kinase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8YXG9 1.1e-26 102 33 4 168 3 aroK Shikimate kinase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A5GQN5 1.65e-26 102 36 4 166 3 aroK Shikimate kinase Synechococcus sp. (strain RCC307)
Q72IW2 1.81e-26 102 42 3 152 3 aroK Shikimate kinase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q5SII4 2.22e-26 101 42 3 152 3 aroK Shikimate kinase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q2JKT7 3.93e-26 101 38 4 148 3 aroK Shikimate kinase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q92ME6 5.69e-26 100 34 2 164 3 aroK Shikimate kinase Rhizobium meliloti (strain 1021)
A1JNV2 8.47e-26 100 35 5 171 3 aroL Shikimate kinase 2 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C0ZZB5 2.89e-25 98 38 2 168 3 aroK Shikimate kinase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
B1I3D6 3.1e-25 99 38 2 167 3 aroK Shikimate kinase Desulforudis audaxviator (strain MP104C)
B2IX35 3.48e-25 98 35 4 166 3 aroK Shikimate kinase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q3ZZK9 4.56e-25 98 32 1 166 3 aroK Shikimate kinase Dehalococcoides mccartyi (strain CBDB1)
A5FRZ4 4.56e-25 98 32 1 166 3 aroK Shikimate kinase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
B1JIG7 4.94e-25 98 35 5 171 3 aroL Shikimate kinase 2 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66DY2 4.94e-25 98 35 5 171 3 aroL Shikimate kinase 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K6Q9 4.94e-25 98 35 5 171 3 aroL Shikimate kinase 2 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FLH5 4.94e-25 98 35 5 171 3 aroL Shikimate kinase 2 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7VE85 5.98e-25 98 38 4 168 3 aroK Shikimate kinase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A4TPJ4 6.46e-25 97 37 5 171 3 aroL Shikimate kinase 2 Yersinia pestis (strain Pestoides F)
Q1CLC0 6.46e-25 97 37 5 171 3 aroL Shikimate kinase 2 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R2W3 6.46e-25 97 37 5 171 3 aroL Shikimate kinase 2 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZC15 6.46e-25 97 37 5 171 3 aroL Shikimate kinase 2 Yersinia pestis
Q1C4F3 6.46e-25 97 37 5 171 3 aroL Shikimate kinase 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q5N4D3 1.1e-24 97 35 4 168 3 aroK Shikimate kinase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31PU5 1.1e-24 97 35 4 168 3 aroK Shikimate kinase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q4JVG1 1.2e-24 97 34 3 163 3 aroK Shikimate kinase Corynebacterium jeikeium (strain K411)
Q9KXQ5 1.51e-24 96 36 4 166 3 aroK Shikimate kinase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C3LKR2 2.17e-24 96 35 3 164 3 aroK Shikimate kinase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P8E3 2.17e-24 96 35 3 164 3 aroK Shikimate kinase Bacillus anthracis (strain A0248)
Q7NH27 2.2e-24 96 40 5 154 3 aroK Shikimate kinase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A9VH19 2.34e-24 96 34 3 162 3 aroK Shikimate kinase Bacillus mycoides (strain KBAB4)
A4FBE7 2.43e-24 96 36 2 160 3 aroK Shikimate kinase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q834S1 3.27e-24 95 36 4 168 3 aroK Shikimate kinase Enterococcus faecalis (strain ATCC 700802 / V583)
B7IXM2 4.7e-24 95 35 3 164 3 aroK Shikimate kinase Bacillus cereus (strain G9842)
A5D373 4.73e-24 95 35 2 170 3 aroK Shikimate kinase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q8DKH7 5.51e-24 95 35 4 168 3 aroK Shikimate kinase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q2JRJ6 5.97e-24 95 35 5 160 3 aroK Shikimate kinase Synechococcus sp. (strain JA-3-3Ab)
Q3Z991 6.07e-24 95 32 1 166 3 aroK Shikimate kinase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
C1ERV8 8.31e-24 94 34 3 164 3 aroK Shikimate kinase Bacillus cereus (strain 03BB102)
P9WPY3 1.43e-23 94 36 4 175 1 aroK Shikimate kinase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPY2 1.43e-23 94 36 4 175 3 aroK Shikimate kinase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U5N8 1.43e-23 94 36 4 175 3 aroK Shikimate kinase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KLN6 1.43e-23 94 36 4 175 3 aroK Shikimate kinase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A4Z3 1.43e-23 94 36 4 175 3 aroK Shikimate kinase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B7JZT6 1.47e-23 94 35 4 168 3 aroK Shikimate kinase Rippkaea orientalis (strain PCC 8801 / RF-1)
B8E0Z4 1.77e-23 94 35 3 166 3 aroK Shikimate kinase Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
O50467 1.8e-23 92 41 1 121 3 aroK Shikimate kinase (Fragment) Neisseria gonorrhoeae
A7GSP5 1.96e-23 93 36 3 163 3 aroK Shikimate kinase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q8RF94 2.55e-23 93 34 0 155 3 aroK Shikimate kinase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B0K0S9 2.62e-23 93 34 2 164 3 aroK Shikimate kinase Thermoanaerobacter sp. (strain X514)
B7JMV9 2.74e-23 93 34 3 164 3 aroK Shikimate kinase Bacillus cereus (strain AH820)
Q9CCS5 3.16e-23 94 37 6 174 3 aroK Shikimate kinase Mycobacterium leprae (strain TN)
B0K9C2 3.81e-23 93 34 2 164 3 aroK Shikimate kinase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B6YQJ0 4.01e-23 93 36 5 168 3 aroK Shikimate kinase Azobacteroides pseudotrichonymphae genomovar. CFP2
Q74BL5 4.15e-23 93 37 2 165 3 aroK Shikimate kinase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A9BCW6 4.29e-23 93 38 4 160 3 aroK Shikimate kinase Prochlorococcus marinus (strain MIT 9211)
A6LFQ8 6.56e-23 92 35 3 151 3 aroK Shikimate kinase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
B9IXM6 9.3e-23 92 33 3 164 3 aroK Shikimate kinase Bacillus cereus (strain Q1)
B7HPD4 9.3e-23 92 33 3 164 3 aroK Shikimate kinase Bacillus cereus (strain AH187)
Q827R9 1.13e-22 92 34 3 165 3 aroK Shikimate kinase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A8MFK5 1.29e-22 91 32 1 164 3 aroK Shikimate kinase Alkaliphilus oremlandii (strain OhILAs)
A4SFH8 1.85e-22 92 35 3 158 3 aroK Shikimate kinase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q2NVB6 2.25e-22 91 35 4 157 3 aroL Shikimate kinase 2 Sodalis glossinidius (strain morsitans)
Q67N09 3.85e-22 90 39 2 168 3 aroK Shikimate kinase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
C6DB04 6.08e-22 90 33 3 161 3 aroL Shikimate kinase 2 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q39X05 6.95e-22 90 34 2 167 3 aroK Shikimate kinase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P10880 7.14e-22 89 34 4 169 1 aroL Shikimate kinase 2 Dickeya chrysanthemi
Q72DN7 8.16e-22 89 33 2 164 3 aroK Shikimate kinase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q3AR93 8.5e-22 90 37 5 171 3 aroK Shikimate kinase Chlorobium chlorochromatii (strain CaD3)
A1BER1 9.06e-22 90 34 3 166 3 aroK Shikimate kinase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q741J8 1.08e-21 89 38 5 174 3 aroK Shikimate kinase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QI60 1.08e-21 89 38 5 174 3 aroK Shikimate kinase Mycobacterium avium (strain 104)
B7NJB4 1.2e-21 89 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B3DXL1 1.25e-21 89 33 2 168 3 aroK Shikimate kinase Methylacidiphilum infernorum (isolate V4)
B2GCQ8 1.29e-21 89 33 2 169 3 aroK Shikimate kinase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q3Z522 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Shigella sonnei (strain Ss046)
Q0T7K0 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Shigella flexneri serotype 5b (strain 8401)
Q325L0 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Shigella boydii serotype 4 (strain Sb227)
B1LIS2 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli (strain SMS-3-5 / SECEC)
B6HZI8 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli (strain SE11)
B7N8U0 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6E1 1.29e-21 89 32 3 160 1 aroL Shikimate kinase 2 Escherichia coli (strain K12)
B1J060 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6E2 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKQ3 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZX38 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O9:H4 (strain HS)
B1XEX7 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli (strain K12 / DH10B)
C4ZTE7 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M333 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O8 (strain IAI1)
B5Z2U0 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6E3 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O157:H7
B7L543 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli (strain 55989 / EAEC)
B7UJL2 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZID7 1.29e-21 89 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83M66 1.35e-21 89 32 3 160 3 aroL Shikimate kinase 2 Shigella flexneri
B2U3Z0 1.35e-21 89 32 3 160 3 aroL Shikimate kinase 2 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q8G5X4 1.42e-21 94 29 2 174 3 aroB Bifunctional shikimate kinase/3-dehydroquinate synthase Bifidobacterium longum (strain NCC 2705)
A8LY07 1.78e-21 88 39 4 139 3 aroK Shikimate kinase Salinispora arenicola (strain CNS-205)
B7MPE9 2.02e-21 88 32 3 160 3 aroL Shikimate kinase 2 Escherichia coli O81 (strain ED1a)
Q32JD7 2.37e-21 88 32 3 160 3 aroL Shikimate kinase 2 Shigella dysenteriae serotype 1 (strain Sd197)
B0JFW8 3.43e-21 88 37 3 151 3 aroK Shikimate kinase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
B3EIT1 5.53e-21 88 36 5 163 3 aroK Shikimate kinase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q3A2J4 9.17e-21 87 37 5 172 3 aroK2 Shikimate kinase 2 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q3B316 9.31e-21 87 32 2 158 3 aroK Shikimate kinase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q6D872 1.11e-20 86 34 3 149 3 aroL Shikimate kinase 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q64ZU2 1.16e-20 87 34 2 143 3 aroK Shikimate kinase Bacteroides fragilis (strain YCH46)
Q5LIQ7 1.16e-20 87 34 2 143 3 aroK Shikimate kinase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q1RFF6 1.32e-20 86 31 3 160 3 aroL Shikimate kinase 2 Escherichia coli (strain UTI89 / UPEC)
A1A860 1.32e-20 86 31 3 160 3 aroL Shikimate kinase 2 Escherichia coli O1:K1 / APEC
B7MD47 1.32e-20 86 31 3 160 3 aroL Shikimate kinase 2 Escherichia coli O45:K1 (strain S88 / ExPEC)
A7MLV5 1.52e-20 86 35 4 168 3 aroL Shikimate kinase 2 Cronobacter sakazakii (strain ATCC BAA-894)
Q8A2B2 1.54e-20 86 34 2 141 1 aroK Shikimate kinase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q8KCL0 2.44e-20 86 31 2 164 3 aroK Shikimate kinase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B3EPX3 4.57e-20 85 31 2 158 3 aroK Shikimate kinase Chlorobium phaeobacteroides (strain BS1)
Q4L6N8 6e-20 84 33 4 172 3 aroK Shikimate kinase Staphylococcus haemolyticus (strain JCSC1435)
Q9RW93 6.08e-20 85 35 3 153 3 aroK Shikimate kinase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q8NWC8 9.12e-20 84 34 2 146 3 aroK Shikimate kinase Staphylococcus aureus (strain MW2)
Q6G928 9.12e-20 84 34 2 146 3 aroK Shikimate kinase Staphylococcus aureus (strain MSSA476)
A8GAI2 1.15e-19 84 32 4 170 3 aroL Shikimate kinase 2 Serratia proteamaculans (strain 568)
A4X608 1.38e-19 84 35 2 166 3 aroK Shikimate kinase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A8Z477 1.54e-19 84 34 2 146 3 aroK Shikimate kinase Staphylococcus aureus (strain USA300 / TCH1516)
A6QH82 1.54e-19 84 34 2 146 3 aroK Shikimate kinase Staphylococcus aureus (strain Newman)
Q5HFM1 1.54e-19 84 34 2 146 3 aroK Shikimate kinase Staphylococcus aureus (strain COL)
Q2FY32 1.54e-19 84 34 2 146 3 aroK Shikimate kinase Staphylococcus aureus (strain NCTC 8325 / PS 47)
P63603 1.78e-19 84 33 4 169 3 aroL Shikimate kinase 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63604 1.78e-19 84 33 4 169 3 aroL Shikimate kinase 2 Salmonella typhi
B5BDE5 1.78e-19 84 33 4 169 3 aroL Shikimate kinase 2 Salmonella paratyphi A (strain AKU_12601)
A9MX50 1.78e-19 84 33 4 169 3 aroL Shikimate kinase 2 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PFV5 1.78e-19 84 33 4 169 3 aroL Shikimate kinase 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5R5X9 1.78e-19 84 33 4 169 3 aroL Shikimate kinase 2 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QTD7 1.78e-19 84 33 4 169 3 aroL Shikimate kinase 2 Salmonella enteritidis PT4 (strain P125109)
B5EWS0 1.78e-19 84 33 4 169 3 aroL Shikimate kinase 2 Salmonella agona (strain SL483)
Q7UU71 1.81e-19 84 30 2 170 3 aroK Shikimate kinase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
B4SW28 1.92e-19 84 33 4 169 3 aroL Shikimate kinase 2 Salmonella newport (strain SL254)
B4T8M7 1.92e-19 84 33 4 169 3 aroL Shikimate kinase 2 Salmonella heidelberg (strain SL476)
Q2J827 1.97e-19 84 39 3 148 3 aroK Shikimate kinase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
B4TZG1 1.98e-19 84 33 4 169 3 aroL Shikimate kinase 2 Salmonella schwarzengrund (strain CVM19633)
A6L011 2.43e-19 83 34 2 141 3 aroK Shikimate kinase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
C0Q7R1 2.97e-19 83 33 4 169 3 aroL Shikimate kinase 2 Salmonella paratyphi C (strain RKS4594)
B5FKP3 2.97e-19 83 33 4 169 3 aroL Shikimate kinase 2 Salmonella dublin (strain CT_02021853)
Q57SH6 2.97e-19 83 33 4 169 3 aroL Shikimate kinase 2 Salmonella choleraesuis (strain SC-B67)
Q00497 3.37e-19 85 39 3 123 1 SK Shikimate kinase, chloroplastic Solanum lycopersicum
B2VIT0 3.96e-19 82 33 5 170 3 aroL Shikimate kinase 2 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
P37944 4.32e-19 83 33 5 172 3 aroK Shikimate kinase Bacillus subtilis (strain 168)
A4W763 5.28e-19 82 28 3 166 3 aroL Shikimate kinase 2 Enterobacter sp. (strain 638)
B9E6S1 7.36e-19 82 33 2 154 3 aroK Shikimate kinase Macrococcus caseolyticus (strain JCSC5402)
B3QMM3 8.61e-19 82 32 3 168 3 aroK Shikimate kinase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A6M250 1.41e-18 81 32 4 170 3 aroK Shikimate kinase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B4S8Z9 1.57e-18 81 30 2 162 3 aroK Shikimate kinase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q6GGG1 1.79e-18 81 36 1 119 3 aroK Shikimate kinase Staphylococcus aureus (strain MRSA252)
P63606 1.83e-18 81 36 1 119 3 aroK Shikimate kinase Staphylococcus aureus (strain N315)
P63605 1.83e-18 81 36 1 119 3 aroK Shikimate kinase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IT66 1.83e-18 81 36 1 119 3 aroK Shikimate kinase Staphylococcus aureus (strain JH9)
A6U209 1.83e-18 81 36 1 119 3 aroK Shikimate kinase Staphylococcus aureus (strain JH1)
A7X2S4 1.83e-18 81 36 1 119 3 aroK Shikimate kinase Staphylococcus aureus (strain Mu3 / ATCC 700698)
A6GZJ6 1.91e-18 80 31 5 171 3 aroK Shikimate kinase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
B1KT67 2.14e-18 80 32 2 156 3 aroK Shikimate kinase Clostridium botulinum (strain Loch Maree / Type A3)
Q3A3N8 2.4e-18 80 33 5 171 3 aroK1 Shikimate kinase 1 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q8ENM6 2.67e-18 80 31 4 168 3 aroK Shikimate kinase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q65NN5 3.16e-18 80 30 5 169 3 aroK Shikimate kinase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q7VIH7 3.95e-18 80 34 5 169 3 aroK Shikimate kinase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
B2TQ47 4.19e-18 79 34 3 143 3 aroK Shikimate kinase Clostridium botulinum (strain Eklund 17B / Type B)
A4IPN9 4.44e-18 80 36 2 127 3 aroK Shikimate kinase Geobacillus thermodenitrificans (strain NG80-2)
Q5KY95 8.12e-18 79 36 2 127 3 aroK Shikimate kinase Geobacillus kaustophilus (strain HTA426)
A8F9S1 8.3e-18 79 32 5 173 3 aroK Shikimate kinase Bacillus pumilus (strain SAFR-032)
Q5NTH4 1e-17 81 31 6 179 1 SK1 Shikimate kinase 1, chloroplastic Oryza sativa subsp. japonica
Q17YU7 1.2e-17 78 33 5 154 3 aroK Shikimate kinase Helicobacter acinonychis (strain Sheeba)
B2HNC7 1.21e-17 79 36 4 172 3 aroK Shikimate kinase Mycobacterium marinum (strain ATCC BAA-535 / M)
C9SE96 1.33e-17 82 32 4 166 3 VDBG_03429 Pentafunctional AROM polypeptide Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136)
A0PPH1 1.34e-17 79 36 4 172 3 aroK Shikimate kinase Mycobacterium ulcerans (strain Agy99)
Q30XS2 1.59e-17 78 32 4 171 3 aroK Shikimate kinase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
C3KXE0 2.19e-17 78 30 2 156 3 aroK Shikimate kinase Clostridium botulinum (strain 657 / Type Ba4)
B2URY7 2.74e-17 77 34 5 151 3 aroK Shikimate kinase Helicobacter pylori (strain Shi470)
Q2S4T0 3.31e-17 78 31 4 176 3 aroK Shikimate kinase Salinibacter ruber (strain DSM 13855 / M31)
Q1CV00 4.02e-17 77 34 5 152 3 aroK Shikimate kinase Helicobacter pylori (strain HPAG1)
B2UYK3 5.72e-17 77 33 3 141 3 aroK Shikimate kinase Clostridium botulinum (strain Alaska E43 / Type E3)
B5Z9T2 6.14e-17 76 34 5 151 3 aroK Shikimate kinase Helicobacter pylori (strain G27)
B6JPQ5 7.44e-17 76 34 5 152 3 aroK Shikimate kinase Helicobacter pylori (strain P12)
Q9KFH9 8.23e-17 77 35 5 145 3 aroK Shikimate kinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
C1FPC6 1.07e-16 76 31 3 157 3 aroK Shikimate kinase Clostridium botulinum (strain Kyoto / Type A2)
P56073 1.15e-16 76 34 5 152 1 aroK Shikimate kinase Helicobacter pylori (strain ATCC 700392 / 26695)
B3QSZ9 1.15e-16 76 30 2 162 3 aroK Shikimate kinase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A5I323 1.18e-16 76 31 3 157 3 aroK Shikimate kinase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FUV4 1.18e-16 76 31 3 157 3 aroK Shikimate kinase Clostridium botulinum (strain ATCC 19397 / Type A)
A4VTX6 1.24e-16 75 33 5 166 3 aroK Shikimate kinase Streptococcus suis (strain 05ZYH33)
A4W070 1.24e-16 75 33 5 166 3 aroK Shikimate kinase Streptococcus suis (strain 98HAH33)
Q9ZMS3 1.32e-16 75 33 5 151 3 aroK Shikimate kinase Helicobacter pylori (strain J99 / ATCC 700824)
A4RD09 1.7e-16 79 33 5 157 3 MGG_01128 Pentafunctional AROM polypeptide Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q5NTH3 1.78e-16 78 31 6 179 1 SK2 Shikimate kinase 2, chloroplastic Oryza sativa subsp. japonica
Q2LUD6 2.21e-16 76 31 2 179 3 aroK Shikimate kinase Syntrophus aciditrophicus (strain SB)
B7LMJ7 2.32e-16 75 31 4 163 3 aroL Shikimate kinase 2 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q7N7B0 3.4e-16 75 29 3 158 3 aroL Shikimate kinase 2 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A5H2Q8 3.84e-16 78 31 5 156 3 ARO1-1 Pentafunctional AROM polypeptide 1 Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239)
Q7X7H9 3.86e-16 77 34 5 138 1 SK3 Shikimate kinase 3, chloroplastic Oryza sativa subsp. japonica
A5H2P4 4.31e-16 78 31 5 156 3 ARO1-2 Pentafunctional AROM polypeptide 2 Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239)
Q9P7R0 4.61e-16 78 34 3 138 1 aro1 Pentafunctional AROM polypeptide Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B1IMQ2 7.51e-16 74 31 3 157 3 aroK Shikimate kinase Clostridium botulinum (strain Okra / Type B1)
Q49XY2 8.99e-16 73 30 3 162 3 aroK Shikimate kinase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B6JVD0 1.15e-15 77 31 2 139 3 aro1 Pentafunctional AROM polypeptide Schizosaccharomyces japonicus (strain yFS275 / FY16936)
C7YZ74 1.37e-15 77 31 5 158 3 NECHADRAFT_47780 Pentafunctional AROM polypeptide Fusarium vanettenii (strain ATCC MYA-4622 / CBS 123669 / FGSC 9596 / NRRL 45880 / 77-13-4)
A7GEL1 2.14e-15 72 30 3 157 3 aroK Shikimate kinase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A8AXY8 2.66e-15 72 31 4 160 3 aroK Shikimate kinase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q8X071 3.4e-15 75 30 5 157 3 aro-1 Pentafunctional AROM polypeptide Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
D1ZA70 6.73e-15 75 31 5 157 3 SMAC_02366 Pentafunctional AROM polypeptide Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell)
B2B223 2.07e-14 73 31 5 161 3 Pa_6_5280 Pentafunctional AROM polypeptide Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383)
Q9SJ05 2.38e-14 72 33 4 124 1 SK1 Shikimate kinase 1, chloroplastic Arabidopsis thaliana
Q8CSF2 3.03e-14 70 30 5 172 3 aroK Shikimate kinase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HP11 3.03e-14 70 30 5 172 3 aroK Shikimate kinase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8GY88 8.54e-14 70 34 4 127 1 SK2 Shikimate kinase 2, chloroplastic Arabidopsis thaliana
P07547 1.03e-13 71 31 4 164 1 aromA Pentafunctional AROM polypeptide Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q03LG8 1.37e-13 68 32 5 162 3 aroK Shikimate kinase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q6CJC4 1.53e-13 71 30 6 168 3 ARO1 Pentafunctional AROM polypeptide Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
C5FQ73 1.58e-13 70 29 3 155 3 MCYG_04845 Pentafunctional AROM polypeptide Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
C5M1X2 1.97e-13 70 30 4 159 3 ARO1 Pentafunctional AROM polypeptide Candida tropicalis (strain ATCC MYA-3404 / T1)
B0STS6 2.63e-13 67 29 3 180 3 aroK Shikimate kinase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SI62 2.63e-13 67 29 3 180 3 aroK Shikimate kinase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A3LSZ2 8.32e-13 68 29 5 162 3 ARO1 Pentafunctional AROM polypeptide Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
B6HAA7 9.08e-13 68 28 4 170 3 aroM Pentafunctional AROM polypeptide Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
B8N4Q9 2.07e-12 67 29 3 162 3 aroM Pentafunctional AROM polypeptide Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
Q2UCP6 2.09e-12 67 29 3 162 3 aroM Pentafunctional AROM polypeptide Aspergillus oryzae (strain ATCC 42149 / RIB 40)
C5JKE6 2.68e-12 67 31 4 151 3 BDBG_02999 Pentafunctional AROM polypeptide Blastomyces gilchristii (strain SLH14081)
B6QWH9 2.76e-12 67 31 4 164 3 aroM-1 Pentafunctional AROM polypeptide 1 Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
Q4WS76 5.3e-12 66 29 3 160 3 aroM Pentafunctional AROM polypeptide Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
B0XRM8 5.35e-12 66 29 3 160 1 aroM Pentafunctional AROM polypeptide Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)
C7GIN5 5.71e-12 66 31 5 165 3 ARO1 Pentafunctional AROM polypeptide Saccharomyces cerevisiae (strain JAY291)
A5FNY2 6.52e-12 63 28 5 169 3 aroK Shikimate kinase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
A1D244 6.66e-12 66 29 3 160 3 aroM Pentafunctional AROM polypeptide Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
P08566 7.47e-12 66 31 5 165 1 ARO1 Pentafunctional AROM polypeptide Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A6ZY89 7.47e-12 66 31 5 165 3 ARO1 Pentafunctional AROM polypeptide Saccharomyces cerevisiae (strain YJM789)
B3LGE9 7.47e-12 66 31 5 165 3 ARO1 Pentafunctional AROM polypeptide Saccharomyces cerevisiae (strain RM11-1a)
C6HCG7 7.47e-12 66 30 4 155 3 HCDG_03716 Pentafunctional AROM polypeptide Ajellomyces capsulatus (strain H143)
C0NL63 7.47e-12 66 30 4 155 3 HCBG_03893 Pentafunctional AROM polypeptide Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432)
C8Z543 7.54e-12 66 31 5 165 3 ARO1 Pentafunctional AROM polypeptide Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse)
A1CP85 7.84e-12 66 28 3 160 3 aroM Pentafunctional AROM polypeptide Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
C1FYJ9 1.03e-11 65 30 4 155 3 PADG_00875 Pentafunctional AROM polypeptide Paracoccidioides brasiliensis (strain Pb18)
Q5AME2 1.06e-11 65 27 4 160 1 ARO1 Pentafunctional AROM polypeptide Candida albicans (strain SC5314 / ATCC MYA-2876)
C0S433 1.1e-11 65 30 4 155 3 PABG_02447 Pentafunctional AROM polypeptide Paracoccidioides brasiliensis (strain Pb03)
C5PA86 1.12e-11 65 30 4 161 3 CPC735_008210 Pentafunctional AROM polypeptide Coccidioides posadasii (strain C735)
C1H8L1 1.25e-11 65 30 4 155 3 PAAG_07102 Pentafunctional AROM polypeptide Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01)
B8M0U4 1.33e-11 65 29 3 164 3 aroM Pentafunctional AROM polypeptide Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
C5DN02 1.4e-11 65 29 5 174 3 ARO1 Pentafunctional AROM polypeptide Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)
C4JYG6 1.52e-11 65 29 4 155 3 UREG_07217 Pentafunctional AROM polypeptide Uncinocarpus reesii (strain UAMH 1704)
Q9WYI3 1.59e-11 65 55 0 54 3 aroKB Bifunctional shikimate kinase/3-dehydroquinate synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B9WFG1 2.82e-11 64 26 4 165 3 ARO1 Pentafunctional AROM polypeptide Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841)
C5G8R4 3.11e-11 64 30 4 151 3 BDCG_01028 Pentafunctional AROM polypeptide Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586)
Q0V3H0 3.12e-11 64 25 3 174 3 SNOG_01444 Pentafunctional AROM polypeptide Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
Q6FIV4 4.92e-11 63 34 5 139 3 ARO1 Pentafunctional AROM polypeptide Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
B6QCA7 4.96e-11 63 30 4 164 3 aroM-2 Pentafunctional AROM polypeptide 2 Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
Q6C1X5 6.12e-11 63 27 6 173 3 ARO1 Pentafunctional AROM polypeptide Yarrowia lipolytica (strain CLIB 122 / E 150)
B4U247 8.16e-11 60 30 6 163 3 aroK Shikimate kinase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C5DVG6 8.17e-11 63 33 6 156 3 ARO1 Pentafunctional AROM polypeptide Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229)
Q04WV5 1.34e-10 60 26 5 181 3 aroK Shikimate kinase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04NM2 1.34e-10 60 26 5 181 3 aroK Shikimate kinase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q0D0F3 1.79e-10 62 27 3 161 3 aroM Pentafunctional AROM polypeptide Aspergillus terreus (strain NIH 2624 / FGSC A1156)
P43906 2.15e-10 59 34 4 163 3 aroK Shikimate kinase Lactococcus lactis subsp. cremoris (strain MG1363)
Q8J294 6.44e-10 60 32 4 148 3 None Pentafunctional AROM polypeptide Thanatephorus cucumeris
Q5XNP0 1.42e-09 59 27 4 165 3 None Pentafunctional AROM polypeptide Sclerotinia sclerotiorum
A7F7H0 1.84e-09 59 27 4 165 3 SS1G_13550 Pentafunctional AROM polypeptide Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)
Q74ZZ1 2.2e-09 58 30 3 126 3 ARO1 Pentafunctional AROM polypeptide Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q12659 2.2e-09 58 30 2 124 3 arom Pentafunctional AROM polypeptide Pneumocystis carinii
Q02XD2 2.27e-09 56 33 4 163 3 aroK Shikimate kinase Lactococcus lactis subsp. cremoris (strain SK11)
Q9CEU1 2e-08 54 32 5 163 3 aroK Shikimate kinase Lactococcus lactis subsp. lactis (strain IL1403)
Q1J634 5.89e-08 53 28 7 171 3 aroK Shikimate kinase Streptococcus pyogenes serotype M4 (strain MGAS10750)
C4Y9D5 8.19e-08 54 30 3 123 3 ARO1 Pentafunctional AROM polypeptide Clavispora lusitaniae (strain ATCC 42720)
P0CM22 9.2e-08 54 32 2 110 3 CNB01990 Pentafunctional AROM polypeptide Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CM23 9.2e-08 54 32 2 110 3 CNBB3730 Pentafunctional AROM polypeptide Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
Q9PK27 1.44e-07 52 29 3 119 3 aroK Shikimate kinase Chlamydia muridarum (strain MoPn / Nigg)
Q1JGC2 1.84e-07 51 31 6 164 3 aroK Shikimate kinase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JL88 1.84e-07 51 31 6 164 3 aroK Shikimate kinase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JB44 1.84e-07 51 31 6 164 3 aroK Shikimate kinase Streptococcus pyogenes serotype M12 (strain MGAS2096)
B5XM06 2.08e-07 51 31 6 164 3 aroK Shikimate kinase Streptococcus pyogenes serotype M49 (strain NZ131)
A2RE14 2.08e-07 51 31 6 164 3 aroK Shikimate kinase Streptococcus pyogenes serotype M5 (strain Manfredo)
A8QCB2 7.08e-07 51 29 8 172 3 MGL_3989 Pentafunctional AROM polypeptide Malassezia globosa (strain ATCC MYA-4612 / CBS 7966)
Q9Z6M1 9.21e-07 50 27 7 172 3 aroK Shikimate kinase Chlamydia pneumoniae
O84372 2.44e-06 48 29 3 115 3 aroK Shikimate kinase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
C4R4R8 6.47e-06 48 27 6 154 3 ARO1 Pentafunctional AROM polypeptide Komagataella phaffii (strain GS115 / ATCC 20864)
Q9BH05 6.9e-06 48 31 3 106 2 THNSL1 Threonine synthase-like 1 Macaca fascicularis

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_10410
Feature type CDS
Gene aroK
Product shikimate kinase AroK
Location 38510 - 39034 (strand: 1)
Length 525 (nucleotides) / 174 (amino acids)

Contig

Accession contig_12
Length 141735 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1596
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01202 Shikimate kinase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0703 Amino acid transport and metabolism (E) E Shikimate kinase

Kegg Ortholog Annotation(s)

Protein Sequence

MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGADVGWVFDVEGEEGFRLREEKIINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETNIEKQLARTQRDKKRPLLQVDEPVREVLVKLADERNPMYEEIADITIHTDDQSAKVVANQIIELLETNS

Flanking regions ( +/- flanking 50bp)

GTGAGCGGGGCGGGTTATCATTAACGAATATTCTTAGTTATACCAAAAACATGGCAGAGAAACGCAATATCTTTCTTGTCGGCCCGATGGGTGCCGGCAAAAGTACTATTGGTCGTCAGCTGGCTCAGCAATTAAATATGGAATTCTTTGATTCCGACCAGGAAATTGAACGCCGCACCGGAGCCGATGTGGGCTGGGTGTTTGATGTCGAAGGTGAAGAAGGTTTTCGCCTGCGTGAAGAAAAAATCATCAATGAACTGACTGAAAAGCAGGGTATCGTCCTGGCTACCGGCGGGGGTTCCGTCAAGTCACGGGAGACCCGCAACCGCCTGTCTGCGCGGGGTGTGGTTGTGTACCTTGAGACCAATATTGAAAAACAACTGGCCCGGACACAGCGCGATAAAAAGCGTCCGTTGTTACAGGTCGATGAGCCGGTCCGGGAAGTCCTGGTTAAACTGGCCGATGAACGCAATCCGATGTATGAAGAGATCGCGGATATTACTATCCACACCGATGATCAGAGTGCAAAAGTGGTTGCAAATCAAATCATTGAACTGTTAGAAACCAACAGTTAATTTCATTTTACCGGCAACATGCGGAGGTGCCATGGAAAAAGTGACTGTGA