Homologs in group_1018

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_11905 EHELCC_11905 100.0 Morganella morganii S2 slyA transcriptional regulator SlyA
NLDBIP_12245 NLDBIP_12245 100.0 Morganella morganii S4 slyA transcriptional regulator SlyA
LHKJJB_12105 LHKJJB_12105 100.0 Morganella morganii S3 slyA transcriptional regulator SlyA
HKOGLL_10720 HKOGLL_10720 100.0 Morganella morganii S5 slyA transcriptional regulator SlyA
F4V73_RS03620 F4V73_RS03620 95.8 Morganella psychrotolerans slyA transcriptional regulator SlyA
PMI_RS06715 PMI_RS06715 76.1 Proteus mirabilis HI4320 slyA transcriptional regulator SlyA

Distribution of the homologs in the orthogroup group_1018

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1018

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8KM02 2.09e-75 223 76 0 143 3 slyA Transcriptional regulator SlyA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JJ73 6.9e-75 222 74 0 143 1 slyA Transcriptional regulator SlyA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
P69989 6.9e-75 222 74 0 143 2 slyA Transcriptional regulator SlyA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIR6 6.9e-75 222 74 0 143 3 slyA Transcriptional regulator SlyA Yersinia pestis (strain Pestoides F)
Q1CIM0 6.9e-75 222 74 0 143 3 slyA Transcriptional regulator SlyA Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZA1 6.9e-75 222 74 0 143 3 slyA Transcriptional regulator SlyA Yersinia pestis bv. Antiqua (strain Angola)
P69988 6.9e-75 222 74 0 143 3 slyA Transcriptional regulator SlyA Yersinia pestis
A7FHL4 6.9e-75 222 74 0 143 3 slyA Transcriptional regulator SlyA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1C786 1.85e-73 219 74 0 143 3 slyA Transcriptional regulator SlyA Yersinia pestis bv. Antiqua (strain Antiqua)
Q9S3W0 4.5e-73 218 74 0 143 3 slyA Transcriptional regulator SlyA Yersinia enterocolitica
A1JNY1 4.5e-73 218 74 0 143 3 slyA Transcriptional regulator SlyA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2NT07 5.92e-73 217 72 0 144 3 slyA Transcriptional regulator SlyA Sodalis glossinidius (strain morsitans)
A8GDX5 9.17e-73 217 74 0 143 3 slyA Transcriptional regulator SlyA Serratia proteamaculans (strain 568)
Q9F6B2 4.3e-71 213 72 0 143 3 slyA Transcriptional regulator SlyA Edwardsiella tarda
Q492T9 7.36e-71 212 72 0 144 3 slyA Transcriptional regulator SlyA Blochmanniella pennsylvanica (strain BPEN)
Q8D2L8 2.65e-70 211 71 0 144 3 slyA Transcriptional regulator SlyA Wigglesworthia glossinidia brevipalpis
C5BE36 7.94e-70 209 72 0 143 3 slyA Transcriptional regulator SlyA Edwardsiella ictaluri (strain 93-146)
B1LEP4 9.57e-70 209 71 0 144 3 slyA Transcriptional regulator SlyA Escherichia coli (strain SMS-3-5 / SECEC)
B7NB96 9.57e-70 209 71 0 144 3 slyA Transcriptional regulator SlyA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A4U4 9.57e-70 209 71 0 144 3 slyA Transcriptional regulator SlyA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MVC0 9.57e-70 209 71 0 144 3 slyA Transcriptional regulator SlyA Escherichia coli O81 (strain ED1a)
B7NTZ0 9.57e-70 209 71 0 144 3 slyA Transcriptional regulator SlyA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7M9Z6 9.57e-70 209 71 0 144 3 slyA Transcriptional regulator SlyA Escherichia coli O45:K1 (strain S88 / ExPEC)
P0A4U5 9.57e-70 209 71 0 144 3 slyA Transcriptional regulator SlyA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P0A8W4 2.08e-69 208 71 0 144 3 slyA Transcriptional regulator SlyA Shigella flexneri
P0A8W2 2.08e-69 208 71 0 144 3 slyA Transcriptional regulator SlyA Escherichia coli (strain K12)
A8A0I5 2.08e-69 208 71 0 144 3 slyA Transcriptional regulator SlyA Escherichia coli O9:H4 (strain HS)
B1XFV4 2.08e-69 208 71 0 144 3 slyA Transcriptional regulator SlyA Escherichia coli (strain K12 / DH10B)
C4ZYA5 2.08e-69 208 71 0 144 3 slyA Transcriptional regulator SlyA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0J9 2.08e-69 208 71 0 144 3 slyA Transcriptional regulator SlyA Escherichia coli O8 (strain IAI1)
B5Z476 2.08e-69 208 71 0 144 3 slyA Transcriptional regulator SlyA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8W3 2.08e-69 208 71 0 144 3 slyA Transcriptional regulator SlyA Escherichia coli O157:H7
B7L5J5 2.08e-69 208 71 0 144 3 slyA Transcriptional regulator SlyA Escherichia coli (strain 55989 / EAEC)
A7ZMA4 2.08e-69 208 71 0 144 3 slyA Transcriptional regulator SlyA Escherichia coli O139:H28 (strain E24377A / ETEC)
P61091 2.59e-69 208 70 0 144 3 slyA Transcriptional regulator SlyA Salmonella typhi
B5BKC5 2.59e-69 208 70 0 144 3 slyA Transcriptional regulator SlyA Salmonella paratyphi A (strain AKU_12601)
C0Q5T8 2.59e-69 208 70 0 144 3 slyA Transcriptional regulator SlyA Salmonella paratyphi C (strain RKS4594)
Q5PH01 2.59e-69 208 70 0 144 3 slyA Transcriptional regulator SlyA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P61090 2.59e-69 208 70 0 144 3 slyA Transcriptional regulator SlyA Salmonella choleraesuis (strain SC-B67)
Q6D5V7 1.03e-68 207 71 0 141 3 slyA Transcriptional regulator SlyA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2U2E2 2.77e-68 206 70 0 144 3 slyA Transcriptional regulator SlyA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q9RB09 3.97e-68 205 70 0 141 3 slyA Transcriptional regulator SlyA Pectobacterium carotovorum subsp. carotovorum
Q9RA96 4.63e-68 205 70 0 141 3 slyA Transcriptional regulator SlyA Serratia sp. (strain ATCC 39006)
C6DK30 4.63e-68 205 70 0 141 3 slyA Transcriptional regulator SlyA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B5XWN4 6.23e-68 204 69 0 144 3 slyA Transcriptional regulator SlyA Klebsiella pneumoniae (strain 342)
P40676 2.79e-67 203 68 0 144 1 slyA Transcriptional regulator SlyA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q7VR54 2.05e-65 198 69 0 143 3 slyA Transcriptional regulator SlyA Blochmanniella floridana
P94578 2.72e-06 47 25 2 111 4 ywoH Uncharacterized HTH-type transcriptional regulator YwoH Bacillus subtilis (strain 168)
P0ACR9 0.000271 42 30 4 139 2 mprA Transcriptional repressor MprA Escherichia coli (strain K12)
P0ACS0 0.000271 42 30 4 139 3 mprA Transcriptional repressor MprA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACS1 0.000271 42 30 4 139 3 mprA Transcriptional repressor MprA Escherichia coli O157:H7
O31672 0.000383 41 23 2 137 2 mhqR HTH-type transcriptional regulator MhqR Bacillus subtilis (strain 168)
P25150 0.000527 41 24 1 114 4 ywaE Uncharacterized HTH-type transcriptional regulator YwaE Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_05685
Feature type CDS
Gene slyA
Product transcriptional regulator SlyA
Location 144294 - 144728 (strand: -1)
Length 435 (nucleotides) / 144 (amino acids)

Contig

Accession contig_5
Length 181448 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1018
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF12802 MarR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1846 Transcription (K) K DNA-binding transcriptional regulator, MarR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06075 MarR family transcriptional regulator, transcriptional regulator for hemolysin - -

Protein Sequence

MELTLGSDLARLVRIWRSLIDHRLKPLKLTQTHWITLYNISLLPPDQSQIQLAKAIGIEQPSLVRTLDQLEEKRLITRHICINDRRAKRIKLTEESEPFIREVDAVIEKTRREILGGITQDELYTLAEIVRKLDNNIVQLHNRN

Flanking regions ( +/- flanking 50bp)

CATGATGGCGTGTATATGCGTCCGTACCGTATTCACATAAGGAGAAATTTGTGGAGTTAACATTGGGATCAGACTTAGCGAGGTTAGTGCGGATTTGGCGATCACTGATTGACCACCGGCTCAAACCACTGAAACTCACACAGACACACTGGATTACACTCTACAATATCAGCCTGCTGCCGCCGGATCAGTCTCAGATTCAGCTGGCAAAAGCGATTGGTATTGAACAGCCGTCGCTGGTCCGCACGCTGGATCAGCTGGAGGAAAAGCGGTTAATCACACGGCATATCTGTATTAATGACCGCAGAGCGAAACGGATTAAACTGACGGAGGAATCCGAACCCTTTATCCGCGAGGTGGACGCGGTAATTGAAAAAACACGGCGCGAAATTCTGGGCGGGATCACGCAGGATGAATTATATACGCTGGCGGAGATTGTCAGAAAACTGGACAATAATATCGTACAGTTGCACAACCGTAACTGACGGCAGGTAATAAAAAAGGCGAAACAGTTGTTTCGCCTTTTGCCGGTAAA