Homologs in group_1038

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_12225 EHELCC_12225 100.0 Morganella morganii S2 rssB two-component system response regulator RssB
NLDBIP_12565 NLDBIP_12565 100.0 Morganella morganii S4 rssB two-component system response regulator RssB
LHKJJB_12425 LHKJJB_12425 100.0 Morganella morganii S3 rssB two-component system response regulator RssB
HKOGLL_11040 HKOGLL_11040 100.0 Morganella morganii S5 rssB two-component system response regulator RssB
F4V73_RS05820 F4V73_RS05820 86.8 Morganella psychrotolerans rssB two-component system response regulator RssB
PMI_RS07220 PMI_RS07220 41.0 Proteus mirabilis HI4320 rssB two-component system response regulator RssB

Distribution of the homologs in the orthogroup group_1038

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1038

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEV3 8.79e-85 262 39 1 336 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 8.79e-85 262 39 1 336 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 8.79e-85 262 39 1 336 3 rssB Regulator of RpoS Escherichia coli O157:H7
P71403 2.27e-09 58 29 2 106 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q44929 2.34e-09 60 34 3 115 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
O69730 6.26e-09 59 31 4 119 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P14375 6.33e-09 60 33 3 124 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q9ZM64 6.4e-09 57 28 2 106 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
Q56312 1.16e-08 56 30 2 107 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P28835 1.36e-08 58 33 3 107 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
Q9APD9 1.48e-08 59 35 2 104 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
Q689G6 1.71e-08 59 29 4 131 2 PRR95 Two-component response regulator-like PRR95 Oryza sativa subsp. japonica
P37478 2.03e-08 57 36 4 112 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q8X613 2.37e-08 58 33 3 124 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
P51586 2.72e-08 55 34 4 127 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
Q6K9T0 3.54e-08 55 31 2 114 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. japonica
Q4GZK8 3.54e-08 55 31 2 114 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. indica
A0QTK2 3.7e-08 57 30 2 108 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P46384 3.77e-08 55 30 4 131 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P25852 5.47e-08 57 33 3 118 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z333 6.26e-08 57 33 3 118 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
Q2HWH1 6.3e-08 54 32 2 114 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. japonica
Q4GZK6 6.3e-08 54 32 2 114 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. indica
P48259 7.28e-08 56 32 3 110 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
O82798 8.02e-08 56 32 5 133 1 ARR4 Two-component response regulator ARR4 Arabidopsis thaliana
Q7XQA6 8.2e-08 54 33 3 116 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. japonica
A2XYV5 8.43e-08 54 33 3 116 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. indica
G0SB31 9.64e-08 57 33 1 106 1 SKN7 Transcription factor SKN7 Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
O25918 1.45e-07 54 30 3 107 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
A1W0A5 1.62e-07 53 26 2 107 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 1.62e-07 53 26 2 107 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 1.62e-07 53 26 2 107 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q55890 1.72e-07 55 33 2 106 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P9WGN1 2.79e-07 54 35 2 111 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 2.79e-07 54 35 2 111 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9WY30 2.86e-07 55 27 2 115 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q2FWH6 2.88e-07 54 32 5 136 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q9ZWS9 3.61e-07 53 30 4 123 1 ARR3 Two-component response regulator ARR3 Arabidopsis thaliana
O31517 4.06e-07 54 27 7 182 3 yesN Uncharacterized transcriptional regulatory protein YesN Bacillus subtilis (strain 168)
Q9CCJ2 4.93e-07 53 29 2 108 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
A2XFB7 4.94e-07 55 30 3 115 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. indica
Q10N34 5.08e-07 55 30 3 115 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. japonica
Q93CB8 5.27e-07 53 29 2 108 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q23917 5.46e-07 55 32 4 110 1 regA 3',5'-cyclic-nucleotide phosphodiesterase regA Dictyostelium discoideum
P9WGM7 5.64e-07 53 29 2 108 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 5.64e-07 53 29 2 108 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 5.64e-07 53 29 2 108 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P43501 6.8e-07 51 31 3 109 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8DPL7 7.54e-07 53 31 4 110 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 7.54e-07 53 31 4 110 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 7.54e-07 53 31 4 110 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q9HUI2 8.09e-07 53 33 4 121 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O78428 8.77e-07 53 27 2 105 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
P28257 9.34e-07 53 28 4 139 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
Q7D9K0 1.2e-06 52 31 3 135 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 1.2e-06 52 31 3 135 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0PWB4 1.41e-06 52 35 2 109 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
P21866 2.85e-06 51 34 4 111 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
Q9I4N3 2.9e-06 52 32 1 104 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0R3I8 3.25e-06 51 33 2 109 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9KT84 3.41e-06 52 23 5 224 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q04848 3.43e-06 52 24 5 233 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q9SB04 3.53e-06 50 28 6 159 1 ARR5 Two-component response regulator ARR5 Arabidopsis thaliana
Q12YX1 3.54e-06 52 32 5 116 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q65JK6 3.94e-06 51 34 5 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q06065 3.97e-06 52 28 1 104 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P0C5S5 4.18e-06 52 30 1 99 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 4.18e-06 52 30 1 99 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
Q87MX7 4.22e-06 52 30 1 99 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1XDC9 4.65e-06 50 28 3 107 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
Q6H468 4.84e-06 49 30 3 120 2 RR11 Two-component response regulator ORR11 Oryza sativa subsp. japonica
B8AFR8 4.84e-06 49 30 3 120 3 RR11 Two-component response regulator ORR11 Oryza sativa subsp. indica
Q5N6V8 5.29e-06 51 30 4 121 3 RR26 Two-component response regulator ORR26 Oryza sativa subsp. japonica
P51358 5.34e-06 50 28 3 107 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
P50350 5.57e-06 50 34 5 118 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
Q1B3X8 5.88e-06 50 33 2 109 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 5.88e-06 50 33 2 109 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 5.88e-06 50 33 2 109 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
P96602 5.94e-06 50 30 4 113 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
P45671 6.18e-06 51 32 1 103 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
Q9ZWS6 6.71e-06 49 30 5 123 1 ARR6 Two-component response regulator ARR6 Arabidopsis thaliana
P45189 7.41e-06 50 28 2 107 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P13792 7.41e-06 50 30 3 107 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
Q9CD68 7.42e-06 50 33 2 109 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
P38889 7.48e-06 51 26 2 146 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q7MM78 8.29e-06 50 29 1 99 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 8.29e-06 50 29 1 99 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
Q7A0I0 9.12e-06 49 27 2 129 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MW2)
Q6G850 9.12e-06 49 27 2 129 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MSSA476)
Q6GFH3 9.12e-06 49 27 2 129 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MRSA252)
Q7A4R9 9.12e-06 49 27 2 129 1 vraR Response regulator protein VraR Staphylococcus aureus (strain N315)
Q7A2Q1 9.12e-06 49 27 2 129 1 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0C0Z1 9.12e-06 49 27 2 129 3 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q0PVB3 9.48e-06 49 29 1 104 2 RR7 Two-component response regulator ORR7 Oryza sativa subsp. japonica
Q9FXD6 1.07e-05 50 31 4 115 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
A1KHB7 1.07e-05 49 33 2 109 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 1.07e-05 49 33 2 109 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P50351 1.09e-05 49 35 5 116 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P9WGM1 1.11e-05 49 34 1 99 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 1.11e-05 49 34 1 99 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 1.11e-05 49 34 1 99 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q742C1 1.13e-05 49 33 2 109 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 1.13e-05 49 33 2 109 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
Q2SFK0 1.16e-05 50 32 4 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Hahella chejuensis (strain KCTC 2396)
A1TEL7 1.18e-05 49 33 2 109 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q8X738 1.25e-05 49 30 2 109 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
Q83RR0 1.35e-05 49 30 2 109 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 1.35e-05 49 30 2 109 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P23836 1.48e-05 48 30 2 109 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
Q0D3B6 1.53e-05 50 29 3 115 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. japonica
P9WGM5 1.55e-05 48 36 4 115 1 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM4 1.55e-05 48 36 4 115 3 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0DM78 1.76e-05 48 32 2 109 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 1.76e-05 48 32 2 109 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 1.76e-05 48 32 2 109 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
Q8Z7H2 1.76e-05 48 32 2 109 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
D0ZV90 1.76e-05 48 32 2 109 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 1.76e-05 48 32 2 109 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A2YQ93 1.87e-05 50 29 3 115 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. indica
Q31S42 1.88e-05 48 33 2 106 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P54662 1.91e-05 48 29 2 106 3 degU Transcriptional regulatory protein DegU Brevibacillus brevis
Q9FPR6 1.99e-05 47 29 3 124 2 ARR17 Two-component response regulator ARR17 Arabidopsis thaliana
P13800 2.11e-05 48 27 5 151 1 degU Transcriptional regulatory protein DegU Bacillus subtilis (strain 168)
P06628 2.37e-05 46 24 2 118 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
P69228 2.48e-05 48 27 9 180 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 2.48e-05 48 27 9 180 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P94439 2.51e-05 48 27 2 118 1 lnrK Transcriptional regulatory protein LnrK Bacillus subtilis (strain 168)
Q51455 2.56e-05 46 28 3 107 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9TLQ4 2.74e-05 48 32 3 113 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
Q8L500 2.85e-05 49 28 3 115 1 APRR9 Two-component response regulator-like APRR9 Arabidopsis thaliana
P62598 3.49e-05 49 30 5 142 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
Q9HU19 3.57e-05 48 29 2 125 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P9WGM9 3.67e-05 48 33 2 109 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 3.67e-05 48 33 2 109 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 3.67e-05 48 33 2 109 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q50136 3.8e-05 47 34 1 99 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
P39486 3.96e-05 47 27 5 122 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
P45709 3.99e-05 45 29 3 113 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
Q57QC3 4.83e-05 47 32 2 109 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
P10576 4.88e-05 48 31 1 103 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
P54443 4.89e-05 47 26 5 158 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
P10577 4.94e-05 48 28 2 139 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
P0AFB8 5.13e-05 48 22 6 232 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 5.13e-05 48 22 6 232 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
Q55933 5.48e-05 47 26 1 134 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q01473 5.74e-05 48 25 2 109 3 rcaC Protein RcaC Microchaete diplosiphon
O29221 7.83e-05 47 31 4 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O05251 8.36e-05 47 31 3 112 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q8KIY1 8.53e-05 48 28 8 197 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
P0A2D5 8.63e-05 45 31 4 113 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 8.63e-05 45 31 4 113 3 cheY Chemotaxis protein CheY Salmonella typhi
Q7A216 8.7e-05 47 29 4 116 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 8.7e-05 47 29 4 116 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 8.7e-05 47 29 4 116 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 8.7e-05 47 29 4 116 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 8.7e-05 47 29 4 116 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 8.7e-05 47 29 4 116 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 8.7e-05 47 29 4 116 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 8.7e-05 47 29 4 116 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 8.7e-05 47 29 4 116 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 8.7e-05 47 29 4 116 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 8.7e-05 47 29 4 116 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 8.7e-05 47 29 4 116 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 8.7e-05 47 29 4 116 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 8.7e-05 47 29 4 116 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 8.7e-05 47 29 4 116 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2RRX2 8.73e-05 47 32 3 104 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
P0AFU5 8.78e-05 47 29 1 104 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 8.78e-05 47 29 1 104 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
Q8CQK0 9.37e-05 46 29 4 116 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 9.37e-05 46 29 4 116 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q07783 9.83e-05 46 33 5 118 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q4A160 0.000105 46 29 4 116 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9KL96 0.000114 46 34 5 106 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q4LAJ9 0.000119 46 29 4 116 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
P44895 0.000119 46 32 4 114 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KQD5 0.000122 44 28 3 106 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 0.000122 44 28 3 106 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q1IQS9 0.000123 47 34 4 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
Q9HV27 0.000157 47 34 2 105 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2ILG8 0.000165 46 31 4 106 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q48F23 0.000168 46 33 5 109 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3A5A8 0.000173 46 35 5 121 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q2HWG4 0.000177 45 30 5 123 2 RR1 Two-component response regulator ORR1 Oryza sativa subsp. japonica
Q4GZL0 0.000189 45 30 5 123 2 RR1 Two-component response regulator ORR1 Oryza sativa subsp. indica
Q6LA42 0.00019 47 27 3 112 1 APRR5 Two-component response regulator-like APRR5 Arabidopsis thaliana
P52942 0.000193 43 24 2 117 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
Q7MBQ5 0.000207 46 34 6 110 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain YJ016)
Q4ZWW3 0.000208 46 33 5 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas syringae pv. syringae (strain B728a)
Q9SHC2 0.000208 44 28 3 127 1 ARR16 Two-component response regulator ARR16 Arabidopsis thaliana
Q93WK5 0.000209 47 25 2 110 1 APRR7 Two-component response regulator-like APRR7 Arabidopsis thaliana
Q8D4X6 0.00021 46 34 6 110 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain CMCP6)
P0DMI2 0.000218 46 33 4 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R4K0 0.000218 46 33 4 103 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
O85128 0.000224 46 33 5 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q5V0B3 0.000237 46 34 5 108 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q9ZWS7 0.000311 45 25 3 123 1 ARR7 Two-component response regulator ARR7 Arabidopsis thaliana
P0AE69 0.000317 43 30 4 113 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 0.000317 43 30 4 113 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 0.000317 43 30 4 113 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
P41789 0.00032 46 22 6 232 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q02540 0.000334 45 30 2 105 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
Q2T8Y6 0.000395 45 31 3 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q0AYL3 0.000404 45 31 7 119 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q04803 0.000419 45 31 4 111 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7G8V2 0.000419 44 26 3 123 1 ARR15 Two-component response regulator ARR15 Arabidopsis thaliana
P0A4I0 0.000423 44 29 1 104 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 0.000423 44 29 1 104 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
Q9LVG4 0.000464 45 27 3 115 1 APRR3 Two-component response regulator-like APRR3 Arabidopsis thaliana
P24072 0.000471 42 28 2 105 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
Q5SML4 0.00049 45 26 3 137 2 HK2 Probable histidine kinase 2 Oryza sativa subsp. japonica
A2YA15 0.00049 45 26 3 137 3 HK2 Probable histidine kinase 2 Oryza sativa subsp. indica
Q5SML5 0.000515 45 28 3 115 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
B8B3I4 0.000515 45 28 3 115 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
A2XE31 0.000546 45 29 4 117 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
Q8Q009 0.000553 45 29 5 117 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8FGP6 0.00056 42 30 4 113 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8H7S7 0.000571 45 29 4 117 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
Q5A872 0.000592 45 29 4 123 1 SLN1 Histidine protein kinase SLN1 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q8D0P1 0.000647 42 30 4 113 3 cheY Chemotaxis protein CheY Yersinia pestis
P30843 0.000649 44 28 2 109 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
Q8TLG9 0.000661 44 30 4 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q9I4F9 0.000669 44 26 1 104 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q06239 0.000691 44 26 6 163 3 vanR Regulatory protein VanR Enterococcus faecium
Q1M7A0 0.000713 43 26 2 130 3 mctR Transcriptional regulatory protein MctR Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P96126 0.000733 42 26 2 117 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
Q9AE24 0.000748 43 27 2 109 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
Q5L0L0 0.000776 44 30 5 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Geobacillus kaustophilus (strain HTA426)
L7N689 0.000783 44 27 1 112 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9F8D7 0.000815 45 29 4 110 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
O49397 0.000838 44 29 3 115 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
Q9FAD7 0.000848 42 29 4 113 3 cheY Chemotaxis protein CheY Enterobacter cloacae
G3XCY6 0.000866 43 31 3 111 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q93P00 0.001 42 30 4 113 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
Q886S8 0.001 44 33 5 109 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_05365
Feature type CDS
Gene rssB
Product two-component system response regulator RssB
Location 82225 - 83253 (strand: -1)
Length 1029 (nucleotides) / 342 (amino acids)
In genomic island -

Contig

Accession contig_5
Length 181448 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1038
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0784 Signal transduction mechanisms (T) T CheY-like REC (receiver) domain, includes chemotaxis protein CheY and sporulation regulator Spo0F

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02485 two-component system, response regulator - -

Protein Sequence

MKQALDGKRLLVIDDDPAFNMALSSYLRLLGATVLSAGDGARAWECIEQGFQPELIFCDLNMPVMTGAEFIARSQSDLPAIPVIVISATQKMSDIDEVLRLGAKDVLLKPLNRLEEVKKLCLSHLYPSFFSPGVLENNDLSGIWAQLQHNVDDVLRLLKQLNPPPSQVLANYQIRYAQLSDSCRAGLVFDVAEFSDNEVAFYCLDISQNTGNGPLMAMLIRVIFNDLLKRYIHNHHRKLPSMTAILNKLNRLLQDAGIPGQLPLLLGYYHTRRKSVLLSSAGISAELRSDNHVIRVNRGIPLGTLSSVYSSQISEFSRHLQCRIWNSSSQIKLSLTPGPHQG

Flanking regions ( +/- flanking 50bp)

CCGGTGTTCCGGGCACGCTGGGTTGTGAGGCCGGGCAGAAAGGGGATGCGATGAAGCAGGCACTGGACGGAAAACGATTGTTAGTCATCGATGACGACCCGGCATTCAATATGGCGCTGTCATCCTATCTGCGCCTTCTCGGTGCCACGGTGTTATCTGCCGGTGATGGTGCGCGCGCATGGGAATGTATAGAACAGGGCTTTCAGCCGGAACTGATTTTCTGTGACCTCAATATGCCGGTGATGACCGGCGCGGAATTTATTGCCCGGTCACAGTCGGATTTACCGGCCATTCCGGTGATTGTTATCTCTGCGACACAAAAAATGTCGGATATCGATGAAGTGCTGCGTCTCGGGGCAAAAGATGTGTTGTTAAAACCCCTGAACAGGCTGGAAGAAGTGAAAAAATTATGTTTGTCCCACCTGTATCCGTCATTTTTCTCACCGGGGGTGCTGGAAAATAATGATCTCTCCGGGATCTGGGCTCAGTTACAACATAATGTGGATGATGTTTTACGTTTATTAAAACAGCTGAATCCGCCGCCGAGCCAGGTGCTGGCCAATTATCAGATCCGCTATGCGCAATTATCTGATAGCTGCCGGGCGGGGCTGGTATTTGATGTGGCAGAATTTTCTGATAATGAAGTGGCGTTTTATTGTCTCGATATCAGTCAGAATACCGGCAACGGCCCGCTGATGGCGATGTTAATCCGCGTCATCTTTAACGATCTGCTTAAACGTTATATTCATAATCACCACCGGAAATTACCGAGTATGACCGCCATCTTAAATAAGCTGAACCGGTTATTACAGGATGCGGGTATTCCGGGACAGTTGCCGCTGCTGCTGGGGTATTATCACACCCGGCGTAAGTCGGTGTTATTGTCCAGTGCCGGTATCAGTGCGGAATTACGCTCTGACAATCATGTGATCCGCGTTAACCGGGGTATTCCGCTGGGGACACTCTCTTCTGTTTATTCCAGTCAGATAAGTGAATTCAGCCGCCATCTGCAATGCCGGATCTGGAACAGCAGCAGTCAGATTAAATTAAGCCTGACCCCCGGACCGCATCAGGGATAATTACCGGACTTTACCAACCCGTTCAGATATTAAACATCTCTTAACACTAA