Homologs in group_1038

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05365 FBDBKF_05365 86.8 Morganella morganii S1 rssB two-component system response regulator RssB
EHELCC_12225 EHELCC_12225 86.8 Morganella morganii S2 rssB two-component system response regulator RssB
NLDBIP_12565 NLDBIP_12565 86.8 Morganella morganii S4 rssB two-component system response regulator RssB
LHKJJB_12425 LHKJJB_12425 86.8 Morganella morganii S3 rssB two-component system response regulator RssB
HKOGLL_11040 HKOGLL_11040 86.8 Morganella morganii S5 rssB two-component system response regulator RssB
PMI_RS07220 PMI_RS07220 43.1 Proteus mirabilis HI4320 rssB two-component system response regulator RssB

Distribution of the homologs in the orthogroup group_1038

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1038

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEV3 1.03e-81 254 39 1 336 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 1.03e-81 254 39 1 336 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 1.03e-81 254 39 1 336 3 rssB Regulator of RpoS Escherichia coli O157:H7
Q9APD9 7.98e-10 63 37 2 104 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
Q8Z333 9.87e-10 63 34 3 118 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P25852 1.08e-09 62 34 3 118 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P51586 1.37e-09 58 37 4 126 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
Q56312 2.76e-09 57 28 0 105 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A0R3I8 3.39e-09 60 36 2 109 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P28835 3.6e-09 60 35 2 108 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
P14375 4.87e-09 60 32 3 122 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q1B3X8 6.09e-09 59 36 2 109 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 6.09e-09 59 36 2 109 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 6.09e-09 59 36 2 109 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
Q8X613 7.92e-09 60 33 3 124 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
G0SB31 8.08e-09 60 34 2 110 1 SKN7 Transcription factor SKN7 Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
Q2FWH6 1.39e-08 58 33 4 136 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
A0QTK2 1.71e-08 57 32 2 108 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P62598 1.75e-08 59 34 3 113 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
P9WGN1 2.78e-08 57 36 2 111 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 2.78e-08 57 36 2 111 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A0PWB4 2.94e-08 57 36 2 109 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
O69730 3.18e-08 57 29 2 108 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM1 3.52e-08 57 38 2 100 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 3.52e-08 57 38 2 100 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 3.52e-08 57 38 2 100 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9I4N3 3.68e-08 58 33 1 104 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1XDC9 3.76e-08 57 31 2 106 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
P46384 4.71e-08 54 29 2 117 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O25918 4.78e-08 56 29 7 172 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
A1TEL7 4.83e-08 56 35 2 109 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
P21866 4.97e-08 56 38 2 103 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
Q9ZWS9 6.71e-08 56 32 4 127 1 ARR3 Two-component response regulator ARR3 Arabidopsis thaliana
P48259 6.88e-08 56 31 3 111 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
P37478 7.06e-08 56 35 4 111 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
O82798 7.94e-08 56 32 4 128 1 ARR4 Two-component response regulator ARR4 Arabidopsis thaliana
P51358 8.31e-08 55 30 2 106 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q9FXD6 8.67e-08 57 33 4 113 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
P24072 8.72e-08 53 32 2 105 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
A1KHB7 8.95e-08 55 35 2 109 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 8.95e-08 55 35 2 109 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q2HWH1 9.75e-08 53 29 2 114 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. japonica
Q4GZK6 9.75e-08 53 29 2 114 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. indica
Q742C1 9.9e-08 55 35 2 109 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 9.9e-08 55 35 2 109 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
Q7XQA6 1e-07 54 32 5 124 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. japonica
A2XYV5 1.24e-07 54 32 5 124 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. indica
P54443 1.27e-07 55 27 4 155 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
P0AFU5 1.3e-07 56 33 1 104 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 1.3e-07 56 33 1 104 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
Q10N34 1.53e-07 56 31 3 115 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. japonica
A2XFB7 1.53e-07 56 31 3 115 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. indica
P9WGM9 1.97e-07 54 35 2 109 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 1.97e-07 54 35 2 109 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 1.97e-07 54 35 2 109 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q6H805 2.1e-07 56 33 3 113 2 RR24 Two-component response regulator ORR24 Oryza sativa subsp. japonica
A2X1N2 2.14e-07 56 33 3 113 3 RR24 Two-component response regulator ORR24 Oryza sativa subsp. indica
P28257 2.71e-07 54 29 3 127 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
P71403 2.82e-07 52 26 2 106 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q50136 2.86e-07 54 36 1 99 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
Q9CCJ2 2.9e-07 54 31 2 108 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
Q93CB8 3.15e-07 53 31 2 108 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WGM7 3.22e-07 53 31 2 108 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 3.22e-07 53 31 2 108 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 3.22e-07 53 31 2 108 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q5SML5 3.6e-07 55 32 5 133 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
Q7D9K0 3.79e-07 54 31 3 133 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 3.79e-07 54 31 3 133 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9HUI2 3.85e-07 53 33 2 115 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B8B3I4 4.01e-07 55 32 5 133 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
Q9ZM64 4.21e-07 51 26 2 106 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
Q9CD68 4.3e-07 53 33 2 109 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
O78428 4.86e-07 53 29 2 106 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
P43501 4.98e-07 51 30 4 110 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P42244 5.47e-07 53 29 4 107 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
A1W0A5 5.72e-07 51 27 2 106 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 5.72e-07 51 27 2 106 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 5.72e-07 51 27 2 106 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
P28787 6.15e-07 54 30 1 103 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
Q0D3B6 6.5e-07 54 30 3 115 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. japonica
Q9WY30 6.72e-07 54 28 2 115 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P0AFB8 6.75e-07 54 29 2 118 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 6.75e-07 54 29 2 118 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
A2YQ93 7.22e-07 54 30 3 115 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. indica
B8H358 8.51e-07 52 27 3 115 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 8.51e-07 52 27 3 115 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A2XE31 9.62e-07 54 30 3 113 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
Q8D0P1 9.64e-07 50 33 3 106 3 cheY Chemotaxis protein CheY Yersinia pestis
Q8H7S7 9.7e-07 54 30 3 113 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
Q6K9T0 1.01e-06 50 29 2 117 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. japonica
Q4GZK8 1.01e-06 50 29 2 117 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. indica
Q8DPL7 1.08e-06 52 32 2 108 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 1.08e-06 52 32 2 108 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 1.08e-06 52 32 2 108 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P41789 1.13e-06 53 28 5 168 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9ZWS6 1.15e-06 51 30 7 158 1 ARR6 Two-component response regulator ARR6 Arabidopsis thaliana
P13792 1.23e-06 52 31 1 105 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
Q12YX1 1.4e-06 53 31 5 116 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
O31517 1.5e-06 53 28 8 186 3 yesN Uncharacterized transcriptional regulatory protein YesN Bacillus subtilis (strain 168)
O49397 1.57e-06 53 31 3 113 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
P96602 1.66e-06 52 28 5 163 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
Q55890 1.72e-06 52 33 3 107 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q2KCH7 1.79e-06 50 29 5 124 3 cheY Probable chemotaxis protein CheY Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P0A2D5 1.83e-06 50 33 4 109 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 1.83e-06 50 33 4 109 3 cheY Chemotaxis protein CheY Salmonella typhi
Q65JK6 1.94e-06 52 35 5 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q87MX7 2.4e-06 52 30 1 99 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q49ZT8 2.5e-06 51 31 4 114 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P38889 2.52e-06 52 26 1 104 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P0C5S5 2.58e-06 52 30 1 99 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 2.58e-06 52 30 1 99 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
Q5N6V8 2.63e-06 52 31 4 119 3 RR26 Two-component response regulator ORR26 Oryza sativa subsp. japonica
Q7MM78 2.65e-06 52 29 1 99 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 2.65e-06 52 29 1 99 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
Q06065 2.71e-06 52 29 1 104 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
Q689G6 2.78e-06 52 26 4 131 2 PRR95 Two-component response regulator-like PRR95 Oryza sativa subsp. japonica
Q2RRX2 2.97e-06 52 34 3 104 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
P0AE69 3.36e-06 49 31 3 108 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 3.36e-06 49 31 3 108 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 3.36e-06 49 31 3 108 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
Q93P00 3.49e-06 49 32 3 106 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
Q8FZ93 3.59e-06 50 25 1 112 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 3.59e-06 50 25 1 112 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 3.59e-06 50 25 1 112 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 3.59e-06 50 25 1 112 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 3.59e-06 50 25 1 112 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 3.59e-06 50 25 1 112 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 3.59e-06 50 25 1 112 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 3.59e-06 50 25 1 112 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
A6WZ81 3.73e-06 50 25 1 112 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q9ZWS7 3.73e-06 50 29 4 126 1 ARR7 Two-component response regulator ARR7 Arabidopsis thaliana
P45709 3.82e-06 48 27 1 112 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
O05251 4.01e-06 50 32 1 103 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q9SB04 4.27e-06 50 29 7 159 1 ARR5 Two-component response regulator ARR5 Arabidopsis thaliana
Q44929 4.66e-06 50 33 3 114 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
P06628 4.7e-06 48 23 3 121 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
Q51455 5.08e-06 48 29 3 106 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8FGP6 5.3e-06 48 31 3 108 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7HD44 6.01e-06 50 31 1 104 1 Anae109_2439 Response regulator receiver protein Anae109_2439 Anaeromyxobacter sp. (strain Fw109-5)
P0DMI2 6.27e-06 51 35 4 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R4K0 6.27e-06 51 35 4 103 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q9AE24 6.3e-06 50 30 5 117 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
Q04849 6.36e-06 51 31 2 105 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q9FAD7 6.49e-06 48 32 4 109 3 cheY Chemotaxis protein CheY Enterobacter cloacae
Q9LZJ8 8.11e-06 50 25 4 147 2 ARR20 Putative two-component response regulator ARR20 Arabidopsis thaliana
Q940D0 8.18e-06 51 32 3 113 1 ARR1 Two-component response regulator ARR1 Arabidopsis thaliana
P52942 8.99e-06 47 26 2 113 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
Q9KT84 9.76e-06 50 29 1 99 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P45671 9.98e-06 50 33 1 103 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
Q6K8X6 1.04e-05 50 30 3 113 2 RR23 Two-component response regulator ORR23 Oryza sativa subsp. japonica
B8AEH1 1.1e-05 50 30 3 113 3 RR23 Two-component response regulator ORR23 Oryza sativa subsp. indica
P0A4H8 1.16e-05 49 30 3 110 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 1.16e-05 49 30 3 110 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04848 1.16e-05 50 26 4 230 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P39663 1.18e-05 49 30 2 123 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O32192 1.25e-05 49 33 3 104 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
Q39T95 1.27e-05 50 35 5 114 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q6AJV3 1.44e-05 50 31 4 120 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q75KW7 1.56e-05 47 28 2 108 3 RR41 Two-component response regulator ORR41 Oryza sativa subsp. japonica
Q1D359 1.92e-05 49 35 3 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Myxococcus xanthus (strain DK1622)
Q9ZWJ9 1.97e-05 50 32 4 115 1 ARR2 Two-component response regulator ARR2 Arabidopsis thaliana
P0A4H5 2.46e-05 46 25 0 104 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 2.46e-05 46 25 0 104 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q2ILG8 2.47e-05 49 33 4 108 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q6H468 2.59e-05 47 28 2 113 2 RR11 Two-component response regulator ORR11 Oryza sativa subsp. japonica
B8AFR8 2.59e-05 47 28 2 113 3 RR11 Two-component response regulator ORR11 Oryza sativa subsp. indica
Q0PVB3 2.62e-05 48 27 1 105 2 RR7 Two-component response regulator ORR7 Oryza sativa subsp. japonica
A8R3S7 2.68e-05 48 30 3 122 2 exaE Transcriptional activator protein ExaE Pseudomonas putida
Q9HU19 2.69e-05 49 29 4 145 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KL96 2.75e-05 48 39 6 105 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9F8D7 2.86e-05 49 29 3 110 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
E0X9C7 3e-05 49 33 5 115 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
P44895 3.09e-05 48 34 4 114 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8L9Y3 3.12e-05 48 30 2 113 1 ARR14 Two-component response regulator ARR14 Arabidopsis thaliana
Q8CQ17 3.17e-05 48 26 1 103 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 3.17e-05 48 26 1 103 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q88RJ6 3.21e-05 49 30 3 125 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9KQD5 3.32e-05 46 30 3 106 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 3.32e-05 46 30 3 106 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q1IQS9 3.34e-05 48 36 4 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
O29221 3.34e-05 48 29 2 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q02540 3.52e-05 48 31 2 104 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
P29267 4.1e-05 48 38 6 107 3 hoxA Hydrogenase transcriptional regulatory protein HoxA Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P54662 4.18e-05 47 30 2 106 3 degU Transcriptional regulatory protein DegU Brevibacillus brevis
P9WGM5 4.22e-05 47 32 2 117 1 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM4 4.22e-05 47 32 2 117 3 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5W4E3 4.54e-05 48 32 3 112 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P69228 4.64e-05 47 26 7 178 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 4.64e-05 47 26 7 178 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7G8V2 4.71e-05 47 29 4 123 1 ARR15 Two-component response regulator ARR15 Arabidopsis thaliana
Q7A1J1 4.86e-05 47 25 1 103 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 4.86e-05 47 25 1 103 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 4.86e-05 47 25 1 103 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 4.86e-05 47 25 1 103 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 4.86e-05 47 25 1 103 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 4.86e-05 47 25 1 103 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 4.86e-05 47 25 1 103 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 4.86e-05 47 25 1 103 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 4.86e-05 47 25 1 103 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 4.86e-05 47 25 1 103 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
O31432 4.88e-05 47 28 3 123 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
P94439 4.89e-05 47 27 2 128 1 lnrK Transcriptional regulatory protein LnrK Bacillus subtilis (strain 168)
Q9TLQ4 4.98e-05 47 32 2 103 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
Q10WZ6 5.32e-05 48 35 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
Q2T8Y6 5.34e-05 48 32 3 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q88AQ2 5.66e-05 48 29 2 119 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P23620 6.52e-05 47 28 2 115 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
L7N689 6.76e-05 47 25 3 149 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P03029 6.81e-05 48 27 2 116 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
P13800 7.09e-05 47 27 6 170 1 degU Transcriptional regulatory protein DegU Bacillus subtilis (strain 168)
G3XCY6 7.65e-05 47 33 3 109 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P45605 7.84e-05 47 28 2 115 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
O74539 8e-05 48 28 3 121 1 mak3 Peroxide stress-activated histidine kinase mak3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q47456 8.09e-05 47 28 1 113 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
P48027 8.48e-05 48 28 3 112 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
P45607 8.52e-05 47 28 2 115 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
P45606 8.92e-05 46 28 2 115 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
Q9I4F9 9.4e-05 46 25 1 104 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0AFJ5 9.52e-05 46 28 2 115 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 9.52e-05 46 28 2 115 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
Q9FPR6 0.000101 45 28 3 128 2 ARR17 Two-component response regulator ARR17 Arabidopsis thaliana
P0DM78 0.000103 46 30 2 109 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 0.000103 46 30 2 109 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 0.000103 46 30 2 109 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 0.000103 46 30 2 109 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 0.000103 46 30 2 109 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P39486 0.000108 46 26 2 111 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
Q8Z7H2 0.00011 46 30 2 109 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
Q8RAZ3 0.000114 47 30 4 113 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P96126 0.000126 45 27 2 117 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
O34903 0.000132 46 26 2 109 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
A1SMR4 0.000148 47 28 4 138 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q8EQQ3 0.000155 46 31 3 116 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
O85128 0.000155 46 32 5 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Agrobacterium fabrum (strain C58 / ATCC 33970)
P45337 0.00017 45 28 1 112 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O34534 0.000174 45 24 2 125 1 citT Transcriptional regulatory protein CitT Bacillus subtilis (strain 168)
Q8X738 0.000188 45 28 2 109 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
Q8KIY1 0.000196 47 31 7 122 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
P0A4I0 0.000208 45 27 1 104 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 0.000208 45 27 1 104 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
Q9RC52 0.000212 45 29 2 102 3 citT Transcriptional regulatory protein CitT Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q83RR0 0.000212 45 28 2 109 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 0.000212 45 28 2 109 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P23836 0.000231 45 28 2 109 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
Q57QC3 0.000248 45 31 2 109 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
P66795 0.000269 45 27 1 112 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 0.000269 45 27 1 112 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
T2KMF4 0.000277 46 27 3 109 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
P52076 0.000281 45 27 2 115 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
Q9C5U0 0.000294 46 26 2 142 1 AHK4 Histidine kinase 4 Arabidopsis thaliana
Q2HWG4 0.0003 45 27 5 123 2 RR1 Two-component response regulator ORR1 Oryza sativa subsp. japonica
Q4GZL0 0.0003 45 27 5 123 2 RR1 Two-component response regulator ORR1 Oryza sativa subsp. indica
Q05522 0.000302 45 33 5 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus subtilis (strain 168)
Q31S42 0.000304 45 31 2 106 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q54SP4 0.000306 46 30 2 116 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
O06978 0.00033 45 29 2 104 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
Q1M7A0 0.000334 45 25 1 129 3 mctR Transcriptional regulatory protein MctR Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q06239 0.000338 45 27 5 162 3 vanR Regulatory protein VanR Enterococcus faecium
P23747 0.000352 45 28 2 118 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0DMC5 0.000367 46 30 1 106 1 rcsC Sensor histidine kinase RcsC Escherichia coli (strain K12)
Q8XBS3 0.000368 44 27 2 115 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
P62646 0.000371 45 28 3 117 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
O25153 0.000383 46 27 2 104 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
P0DMK7 0.000404 44 28 2 112 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 0.000404 44 28 2 112 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q97GZ3 0.000427 45 27 4 122 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P18769 0.000465 45 28 2 103 1 frzE Gliding motility regulatory protein Myxococcus xanthus
P10577 0.000497 45 32 1 106 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
O83639 0.000558 45 32 4 109 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
Q8D4X6 0.000587 45 34 6 110 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain CMCP6)
Q00934 0.00059 45 31 4 118 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0C5S3 0.000636 43 30 1 106 3 actR Acid tolerance regulatory protein ActR Rhizobium meliloti (strain 1021)
Q7MBQ5 0.000638 44 34 6 110 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain YJ016)
Q6LA42 0.00075 45 25 3 112 1 APRR5 Two-component response regulator-like APRR5 Arabidopsis thaliana
Q9HV27 0.00077 44 32 2 105 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KM66 0.000831 45 25 2 116 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P58662 0.00085 45 29 1 106 3 rcsC Sensor histidine kinase RcsC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q56128 0.00085 45 29 1 106 3 rcsC Sensor histidine kinase RcsC Salmonella typhi
Q86AT9 0.000853 45 24 3 113 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
Q4LAJ9 0.000857 43 27 4 115 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
P35163 0.001 43 29 3 109 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
P13632 0.001 44 25 2 124 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
Q9AAK0 0.001 44 29 4 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A6UEL7 0.001 43 30 1 106 3 actR Acid tolerance regulatory protein ActR Sinorhizobium medicae (strain WSM419)
P96686 0.001 43 31 1 77 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05820
Feature type CDS
Gene rssB
Product two-component system response regulator RssB
Location 1239134 - 1240162 (strand: -1)
Length 1029 (nucleotides) / 342 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1038
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0784 Signal transduction mechanisms (T) T CheY-like REC (receiver) domain, includes chemotaxis protein CheY and sporulation regulator Spo0F

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02485 two-component system, response regulator - -

Protein Sequence

MKRALDEKRILVIDDDPAFNMTLSSYLRHLGATVLSAEEGARALLCIENGFQPELIFCDLNMPVMSGTEFIAVIRTVLPDVPVIVISATQKMSDIDDALRLGAKDVLLKPLNRLEEVKKLCLSHFYPLFFAPGLLEKNDLSGIWSQLQHNVDDVLRLLKQLTPPPTQVLANYQIRYAQLSDACQTGLVFDVAEFSDNEVAFYCLDISKNTGNGPLVAMLIRVIFNDLLKRYIHNNHRRLPSMTAILNKLNTLLQDAGIPGQLPLLLGYYHTQRKSVLLSSAGISAELRSENNVIRVNRGIPLGTLSAVYSSQISEFSPHLQCRIWNGSSQIKLSLTPGPRHG

Flanking regions ( +/- flanking 50bp)

ACCGGTGTTTGTGCCGGTCTGTGTAGTCATGCGGGGAATGAGGGAATGCCATGAAAAGAGCACTGGATGAAAAACGAATTTTAGTCATTGACGACGACCCGGCATTCAATATGACGCTGTCATCGTATTTACGACACCTCGGTGCGACAGTATTGTCTGCAGAAGAGGGGGCCCGGGCTCTGTTATGTATTGAAAACGGCTTTCAGCCGGAGCTGATATTTTGTGATTTGAATATGCCGGTGATGAGTGGCACAGAATTTATCGCCGTTATACGGACAGTGTTACCGGATGTCCCGGTGATTGTGATTTCTGCAACTCAAAAAATGTCTGATATTGATGACGCGCTGCGCCTTGGTGCAAAAGATGTGTTGCTCAAACCGCTCAACCGGCTGGAAGAGGTCAAAAAACTGTGTCTGTCTCATTTCTATCCCTTATTTTTTGCCCCGGGCTTGCTGGAAAAAAATGACCTGTCCGGTATCTGGTCGCAGCTGCAACATAATGTGGATGATGTTTTACGTTTATTAAAACAGCTTACCCCGCCGCCTACTCAGGTACTGGCCAATTATCAGATCCGTTATGCGCAATTATCGGATGCCTGCCAGACCGGGCTGGTATTTGATGTGGCGGAGTTTTCAGATAACGAAGTGGCATTTTATTGTCTCGATATCAGCAAAAACACCGGGAATGGTCCGCTGGTGGCGATGTTAATCCGCGTTATTTTTAACGATTTGCTTAAACGTTATATTCATAATAATCACCGCCGGTTACCCAGTATGACCGCGATTTTAAATAAGCTGAATACCCTGTTGCAGGATGCCGGTATTCCGGGGCAGTTACCCTTGTTGCTGGGGTATTATCATACTCAACGCAAATCGGTATTACTGTCCAGTGCAGGGATCAGCGCGGAACTGCGCTCAGAAAATAACGTTATTCGTGTAAACAGAGGTATTCCGCTGGGAACGCTCTCGGCTGTTTATTCCAGTCAGATAAGTGAATTCAGCCCTCATCTGCAATGCCGGATATGGAACGGCAGTAGTCAGATCAAATTAAGTTTAACGCCGGGACCCCGTCACGGGTAATTTCAGTGGCTTATCAACCCGGTCAGATATTAAACATCTCTTAACATCAA