Homologs in group_2581

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_03330 EHELCC_03330 100.0 Morganella morganii S2 soxR DNA-binding transcriptional regulator, MerR family
NLDBIP_00130 NLDBIP_00130 100.0 Morganella morganii S4 soxR DNA-binding transcriptional regulator, MerR family
LHKJJB_01905 LHKJJB_01905 100.0 Morganella morganii S3 soxR DNA-binding transcriptional regulator, MerR family
HKOGLL_01945 HKOGLL_01945 100.0 Morganella morganii S5 soxR DNA-binding transcriptional regulator, MerR family
F4V73_RS05300 F4V73_RS05300 84.3 Morganella psychrotolerans - MerR family transcriptional regulator

Distribution of the homologs in the orthogroup group_2581

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2581

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8FK74 8.36e-16 72 35 4 122 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XD09 4.4e-15 70 34 4 122 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O157:H7
P0A9G5 5.28e-15 70 34 4 122 3 cueR HTH-type transcriptional regulator CueR Shigella flexneri
P0A9G4 5.28e-15 70 34 4 122 1 cueR HTH-type transcriptional regulator CueR Escherichia coli (strain K12)
Q93CH6 1.1e-14 69 36 5 122 1 cueR HTH-type transcriptional regulator CueR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z8S3 1.28e-14 68 36 5 122 3 cueR HTH-type transcriptional regulator CueR Salmonella typhi
P0C6D2 1.91e-13 65 34 4 138 3 cueR HTH-type transcriptional regulator CueR Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2W6 1.91e-13 65 34 4 138 3 cueR HTH-type transcriptional regulator CueR Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q8ZCA8 1.06e-12 63 33 3 121 3 cueR HTH-type transcriptional regulator CueR Yersinia pestis
Q9HV30 1.07e-12 63 32 3 128 3 PA4778 Uncharacterized HTH-type transcriptional regulator PA4778 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9X5V4 1.17e-11 61 34 2 120 4 hmrR HTH-type transcriptional regulator HmrR Rhizobium leguminosarum bv. viciae
P45277 2.48e-10 57 36 3 116 3 zntR HTH-type transcriptional regulator ZntR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P22896 4.34e-10 57 34 3 107 4 merR Mercuric resistance operon regulatory protein (Fragment) Acidithiobacillus ferrooxidans
P22874 1.61e-09 55 34 5 123 4 merR Mercuric resistance operon regulatory protein Staphylococcus aureus
Q9X5X4 2.16e-09 55 28 3 121 1 hmrR HTH-type transcriptional regulator HmrR Sinorhizobium medicae (strain WSM419)
P44617 3.78e-09 54 33 4 120 3 HI_0293 Probable heavy metal-dependent transcriptional regulator HI_0293 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P58379 6.37e-09 54 26 3 134 3 hmrR2 Heavy metal-dependent transcription regulator 2 Rhizobium meliloti (strain 1021)
Q9ZHI4 2.09e-08 53 31 2 123 4 soxR HTH-type transcriptional activator SoxR homolog Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P0ACS5 2.59e-08 52 35 3 111 1 zntR HTH-type transcriptional regulator ZntR Escherichia coli (strain K12)
P0ACS6 2.59e-08 52 35 3 111 3 zntR HTH-type transcriptional regulator ZntR Escherichia coli O157:H7
P22853 9.24e-08 50 31 5 121 1 merR1 Mercuric resistance operon regulatory protein Bacillus cereus
P58378 4.85e-07 49 25 4 131 3 hmrR1 Heavy metal-dependent transcription regulator 1 Rhizobium meliloti (strain 1021)
O07586 5.96e-07 48 35 3 101 4 cueR HTH-type transcriptional regulator CueR Bacillus subtilis (strain 168)
P50330 1.3e-06 49 30 3 114 4 nolA Nodulation protein NolA Bradyrhizobium sp. (strain NC92)
P50329 1.87e-06 48 31 3 114 4 nolA Nodulation protein NolA (Fragment) Bradyrhizobium elkanii
P13111 1.93e-06 47 30 4 123 4 merR Mercuric resistance operon regulatory protein Serratia marcescens
O06474 1.95e-06 47 34 6 126 2 yfmP HTH-type transcriptional regulator YfmP Bacillus subtilis (strain 168)
Q51506 3.28e-06 47 26 2 125 3 soxR Redox-sensitive transcriptional activator SoxR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P69413 5.03e-06 46 30 4 123 3 merR Mercuric resistance operon regulatory protein Pseudomonas sp.
P0A184 5.03e-06 46 30 4 123 3 merR Mercuric resistance operon regulatory protein Pseudomonas fluorescens
P0A183 5.03e-06 46 30 4 123 1 merR Mercuric resistance operon regulatory protein Pseudomonas aeruginosa
P22537 5.77e-06 47 31 3 114 2 nolA Nodulation protein NolA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P0A2Q9 1.27e-05 45 29 4 123 4 merR Mercuric resistance operon regulatory protein Shigella flexneri
P0A2Q8 1.27e-05 45 29 4 123 3 merR Mercuric resistance operon regulatory protein Salmonella typhi
Q55963 1.45e-05 45 31 2 106 4 slr0701 Uncharacterized HTH-type transcriptional regulator slr0701 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0A4T9 2.55e-05 45 34 1 67 1 tipA HTH-type transcriptional activator TipA Streptomyces lividans
P0A4T8 2.55e-05 45 34 1 67 3 tipA HTH-type transcriptional activator TipA Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O06008 2.67e-05 44 33 4 106 1 adhR HTH-type transcriptional regulator AdhR Bacillus subtilis (strain 168)
P0ACS4 7.18e-05 43 28 2 118 3 soxR Redox-sensitive transcriptional activator SoxR Shigella flexneri
P0ACS2 7.18e-05 43 28 2 118 1 soxR Redox-sensitive transcriptional activator SoxR Escherichia coli (strain K12)
P0ACS3 7.18e-05 43 28 2 118 3 soxR Redox-sensitive transcriptional activator SoxR Escherichia coli O157:H7
P0A2R0 9.41e-05 43 28 2 118 3 soxR Redox-sensitive transcriptional activator SoxR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2R1 9.41e-05 43 28 2 118 3 soxR Redox-sensitive transcriptional activator SoxR Salmonella typhi
Q45666 0.000688 40 47 0 48 1 tnrA HTH-type transcriptional regulator TnrA Bacillus subtilis (strain 168)
P37582 0.001 40 46 0 41 1 glnR HTH-type transcriptional regulator GlnR Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_02860
Feature type CDS
Gene soxR
Product DNA-binding transcriptional regulator, MerR family
Location 266614 - 267036 (strand: 1)
Length 423 (nucleotides) / 140 (amino acids)

Contig

Accession contig_2
Length 292399 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2581
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF13411 MerR HTH family regulatory protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0789 Transcription (K) K DNA-binding transcriptional regulator, MerR family

Protein Sequence

MKMIDIGRVAELTGLTTATIRYYESKGLITPAGRRGLTRIYDEEVLTRLSLIILAKQGHFSLDEIAVMLSELPSKGIERTAIQAKITEIDQKIRELQNLKQGLLHIEQCPAENHLACPKFRKILSVSLKKNRSKTVKNPA

Flanking regions ( +/- flanking 50bp)

ACACCGGACGGTAAACAGATCCGCTCCCTGGCATCCCTGCGTGATGCAGCATGAAAATGATTGATATCGGCCGTGTCGCAGAGCTGACCGGCCTGACAACCGCCACCATCCGCTATTATGAAAGCAAAGGCCTGATCACGCCTGCCGGGCGCCGGGGCCTGACCCGCATTTATGATGAAGAGGTGCTGACACGGCTGTCCCTGATCATTCTCGCCAAACAGGGACATTTTTCACTGGATGAAATCGCGGTAATGCTCAGCGAACTGCCGTCAAAAGGGATTGAACGGACGGCAATTCAGGCAAAAATCACAGAAATTGACCAGAAAATCCGCGAGCTGCAAAATCTGAAACAGGGATTGCTGCATATTGAGCAGTGCCCGGCAGAAAACCATCTGGCGTGCCCGAAGTTCCGCAAAATCCTGAGTGTCAGTCTGAAAAAAAACAGAAGCAAAACGGTGAAAAATCCCGCTTGACTTAAAGTTAACTTGAAGTTGTATCATCCGGCATACTGATTTCCGTCTGA