Homologs in group_2606

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02860 FBDBKF_02860 84.3 Morganella morganii S1 soxR DNA-binding transcriptional regulator, MerR family
EHELCC_03330 EHELCC_03330 84.3 Morganella morganii S2 soxR DNA-binding transcriptional regulator, MerR family
NLDBIP_00130 NLDBIP_00130 84.3 Morganella morganii S4 soxR DNA-binding transcriptional regulator, MerR family
LHKJJB_01905 LHKJJB_01905 84.3 Morganella morganii S3 soxR DNA-binding transcriptional regulator, MerR family
HKOGLL_01945 HKOGLL_01945 84.3 Morganella morganii S5 soxR DNA-binding transcriptional regulator, MerR family

Distribution of the homologs in the orthogroup group_2606

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2606

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8FK74 7.62e-17 74 36 3 121 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8Z8S3 1e-16 74 37 3 121 3 cueR HTH-type transcriptional regulator CueR Salmonella typhi
Q93CH6 1.02e-16 74 37 3 121 1 cueR HTH-type transcriptional regulator CueR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XD09 1.29e-16 74 36 3 121 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O157:H7
P0A9G5 1.52e-16 73 36 3 121 3 cueR HTH-type transcriptional regulator CueR Shigella flexneri
P0A9G4 1.52e-16 73 36 3 121 1 cueR HTH-type transcriptional regulator CueR Escherichia coli (strain K12)
P0C6D2 1.83e-13 66 34 3 137 3 cueR HTH-type transcriptional regulator CueR Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2W6 1.83e-13 66 34 3 137 3 cueR HTH-type transcriptional regulator CueR Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q8ZCA8 2.44e-13 65 34 3 121 3 cueR HTH-type transcriptional regulator CueR Yersinia pestis
Q9HV30 2.51e-12 62 33 3 121 3 PA4778 Uncharacterized HTH-type transcriptional regulator PA4778 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9X5X4 1.13e-11 61 30 3 121 1 hmrR HTH-type transcriptional regulator HmrR Sinorhizobium medicae (strain WSM419)
P58379 1.36e-11 61 29 3 136 3 hmrR2 Heavy metal-dependent transcription regulator 2 Rhizobium meliloti (strain 1021)
P44617 6.84e-11 59 35 4 120 3 HI_0293 Probable heavy metal-dependent transcriptional regulator HI_0293 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9X5V4 7.52e-11 58 30 2 120 4 hmrR HTH-type transcriptional regulator HmrR Rhizobium leguminosarum bv. viciae
P58378 5.82e-10 57 29 4 122 3 hmrR1 Heavy metal-dependent transcription regulator 1 Rhizobium meliloti (strain 1021)
P22896 9.13e-09 53 41 1 67 4 merR Mercuric resistance operon regulatory protein (Fragment) Acidithiobacillus ferrooxidans
P45277 1.28e-08 53 35 3 116 3 zntR HTH-type transcriptional regulator ZntR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P22874 1.92e-08 52 33 5 125 4 merR Mercuric resistance operon regulatory protein Staphylococcus aureus
Q9ZHI4 8.44e-08 51 30 3 126 4 soxR HTH-type transcriptional activator SoxR homolog Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P22853 2e-07 50 31 5 123 1 merR1 Mercuric resistance operon regulatory protein Bacillus cereus
Q51506 3.08e-07 50 30 2 123 3 soxR Redox-sensitive transcriptional activator SoxR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0ACS5 3.77e-07 49 34 4 111 1 zntR HTH-type transcriptional regulator ZntR Escherichia coli (strain K12)
P0ACS6 3.77e-07 49 34 4 111 3 zntR HTH-type transcriptional regulator ZntR Escherichia coli O157:H7
P0ACS4 5.5e-06 46 28 1 121 3 soxR Redox-sensitive transcriptional activator SoxR Shigella flexneri
P0ACS2 5.5e-06 46 28 1 121 1 soxR Redox-sensitive transcriptional activator SoxR Escherichia coli (strain K12)
P0ACS3 5.5e-06 46 28 1 121 3 soxR Redox-sensitive transcriptional activator SoxR Escherichia coli O157:H7
P13111 6e-06 46 30 4 120 4 merR Mercuric resistance operon regulatory protein Serratia marcescens
P0A2R0 6.71e-06 46 28 1 121 3 soxR Redox-sensitive transcriptional activator SoxR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2R1 6.71e-06 46 28 1 121 3 soxR Redox-sensitive transcriptional activator SoxR Salmonella typhi
P69413 8.77e-06 45 31 6 122 3 merR Mercuric resistance operon regulatory protein Pseudomonas sp.
P0A184 8.77e-06 45 31 6 122 3 merR Mercuric resistance operon regulatory protein Pseudomonas fluorescens
P0A183 8.77e-06 45 31 6 122 1 merR Mercuric resistance operon regulatory protein Pseudomonas aeruginosa
O07586 9.78e-06 45 31 4 108 4 cueR HTH-type transcriptional regulator CueR Bacillus subtilis (strain 168)
O06008 2.09e-05 44 34 4 106 1 adhR HTH-type transcriptional regulator AdhR Bacillus subtilis (strain 168)
P0A4T9 2.38e-05 45 33 1 69 1 tipA HTH-type transcriptional activator TipA Streptomyces lividans
P0A4T8 2.38e-05 45 33 1 69 3 tipA HTH-type transcriptional activator TipA Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q55963 4.06e-05 43 31 2 106 4 slr0701 Uncharacterized HTH-type transcriptional regulator slr0701 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0A2Q9 4.81e-05 43 29 4 120 4 merR Mercuric resistance operon regulatory protein Shigella flexneri
P0A2Q8 4.81e-05 43 29 4 120 3 merR Mercuric resistance operon regulatory protein Salmonella typhi
O06474 7.29e-05 43 32 5 125 2 yfmP HTH-type transcriptional regulator YfmP Bacillus subtilis (strain 168)
P37582 0.00013 42 51 0 41 1 glnR HTH-type transcriptional regulator GlnR Bacillus subtilis (strain 168)
P50330 0.000434 42 26 3 118 4 nolA Nodulation protein NolA Bradyrhizobium sp. (strain NC92)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05300
Feature type CDS
Gene -
Product MerR family transcriptional regulator
Location 1126491 - 1126913 (strand: 1)
Length 423 (nucleotides) / 140 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2606
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF13411 MerR HTH family regulatory protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0789 Transcription (K) K DNA-binding transcriptional regulator, MerR family

Protein Sequence

MKLLNIGRVAQLTGLTTATIRYYESKGLITPAGRKGLTRIYEPEVLTRLSLIILAKQGHFSLDEIAVMLSELPEKGIERTAIKEKIAEIDDKILELQKLKQGLLHIEQCPAENHLECPNFRKILAVSLKKNREKMIKTPS

Flanking regions ( +/- flanking 50bp)

GGAAAACAGATCCATTCACTCGCCTCACTCCGCAAACTGACAGGACAGGCATGAAATTACTGAACATCGGGCGGGTTGCACAACTGACCGGTCTGACAACGGCCACCATTCGCTATTATGAGAGCAAAGGACTGATTACGCCCGCCGGGCGTAAAGGTCTGACCCGTATCTATGAGCCGGAGGTACTGACCCGGCTCTCTCTGATCATACTGGCAAAACAGGGGCATTTTTCGCTGGATGAAATCGCGGTGATGCTCAGTGAATTACCGGAAAAAGGCATCGAACGGACAGCGATTAAAGAAAAAATCGCCGAAATTGATGATAAAATACTCGAACTGCAAAAATTGAAGCAGGGATTACTGCATATTGAGCAATGTCCGGCAGAAAATCACCTGGAGTGTCCGAATTTCCGGAAAATCCTTGCGGTCAGCCTGAAAAAAAACAGAGAAAAAATGATCAAAACCCCCTCTTGACTTCAAGTTAACTTGAAGTTGTATCATCCGGCATACTGATTTCCATCTTA