Homologs in group_47

Help

12 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06890 FBDBKF_06890 45.9 Morganella morganii S1 ebsC Cys-tRNA(Pro) deacylase, prolyl-tRNA editing enzyme YbaK/EbsC
EHELCC_02335 EHELCC_02335 100.0 Morganella morganii S2 ebsC Cys-tRNA(Pro) deacylase, prolyl-tRNA editing enzyme YbaK/EbsC
EHELCC_04080 EHELCC_04080 46.3 Morganella morganii S2 ebsC Cys-tRNA(Pro) deacylase, prolyl-tRNA editing enzyme YbaK/EbsC
NLDBIP_01125 NLDBIP_01125 100.0 Morganella morganii S4 ebsC Cys-tRNA(Pro) deacylase, prolyl-tRNA editing enzyme YbaK/EbsC
NLDBIP_04080 NLDBIP_04080 46.3 Morganella morganii S4 ebsC Cys-tRNA(Pro) deacylase, prolyl-tRNA editing enzyme YbaK/EbsC
LHKJJB_00910 LHKJJB_00910 100.0 Morganella morganii S3 ebsC Cys-tRNA(Pro) deacylase, prolyl-tRNA editing enzyme YbaK/EbsC
LHKJJB_09910 LHKJJB_09910 46.3 Morganella morganii S3 ebsC Cys-tRNA(Pro) deacylase, prolyl-tRNA editing enzyme YbaK/EbsC
HKOGLL_00950 HKOGLL_00950 100.0 Morganella morganii S5 ebsC Cys-tRNA(Pro) deacylase, prolyl-tRNA editing enzyme YbaK/EbsC
HKOGLL_09065 HKOGLL_09065 46.3 Morganella morganii S5 ebsC Cys-tRNA(Pro) deacylase, prolyl-tRNA editing enzyme YbaK/EbsC
F4V73_RS01075 F4V73_RS01075 44.4 Morganella psychrotolerans - YbaK/prolyl-tRNA synthetase associated domain-containing protein
F4V73_RS04210 F4V73_RS04210 87.7 Morganella psychrotolerans - YbaK/EbsC family protein
PMI_RS03230 PMI_RS03230 51.2 Proteus mirabilis HI4320 - YbaK/prolyl-tRNA synthetase associated domain-containing protein

Distribution of the homologs in the orthogroup group_47

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_47

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64483 5.54e-42 140 41 1 161 1 proXp-y Multifunctional Ser/Thr-tRNA deacylase ProXp-y Escherichia coli (strain K12)
P64484 5.54e-42 140 41 1 161 3 proXp-y Multifunctional Ser/Thr-tRNA deacylase ProXp-y Escherichia coli O157:H7
C1EP43 2.99e-07 52 30 1 88 3 proS Proline--tRNA ligase Bacillus cereus (strain 03BB102)
B7JJ97 2.99e-07 52 30 1 88 3 proS Proline--tRNA ligase Bacillus cereus (strain AH820)
C3L7A8 2.99e-07 52 30 1 88 3 proS Proline--tRNA ligase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P5M1 2.99e-07 52 30 1 88 3 proS Proline--tRNA ligase Bacillus anthracis (strain A0248)
Q81WL6 2.99e-07 52 30 1 88 3 proS1 Proline--tRNA ligase 1 Bacillus anthracis
A0RHJ2 2.99e-07 52 30 1 88 3 proS1 Proline--tRNA ligase 1 Bacillus thuringiensis (strain Al Hakam)
Q636K7 3.05e-07 52 30 1 88 3 proS1 Proline--tRNA ligase 1 Bacillus cereus (strain ZK / E33L)
Q9L4Q7 3.5e-07 50 28 5 152 1 proX Prolyl-tRNA editing protein ProX Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / CCUG 9281 / NCIMB 10654 / HF)
Q6HEZ6 4.5e-07 51 29 1 88 3 proS1 Proline--tRNA ligase 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
A7GRE9 1.29e-06 50 29 1 88 3 proS Proline--tRNA ligase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7IUH7 2.28e-06 49 29 1 88 3 proS Proline--tRNA ligase Bacillus cereus (strain G9842)
B7HLF2 3.15e-06 49 29 1 88 3 proS Proline--tRNA ligase Bacillus cereus (strain AH187)
Q732Q0 3.15e-06 49 29 1 88 3 proS1 Proline--tRNA ligase 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q65JJ1 3.4e-06 49 31 1 90 3 proS Proline--tRNA ligase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B9IVA8 6.01e-06 48 29 1 88 3 proS Proline--tRNA ligase Bacillus cereus (strain Q1)
B7HDU2 6.8e-06 48 28 1 88 3 proS Proline--tRNA ligase Bacillus cereus (strain B4264)
Q819Y4 2.34e-05 47 28 1 88 3 proS1 Proline--tRNA ligase 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A9VT57 3.94e-05 46 27 1 88 3 proS Proline--tRNA ligase Bacillus mycoides (strain KBAB4)
B3E1X5 8.44e-05 45 33 1 87 3 proS Proline--tRNA ligase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q8CST7 0.000243 43 25 2 93 3 proS Proline--tRNA ligase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPS8 0.000243 43 25 2 93 3 proS Proline--tRNA ligase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B2GBM5 0.000417 43 26 1 94 3 proS Proline--tRNA ligase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_01865
Feature type CDS
Gene ebsC
Product Cys-tRNA(Pro) deacylase, prolyl-tRNA editing enzyme YbaK/EbsC
Location 61185 - 61676 (strand: -1)
Length 492 (nucleotides) / 163 (amino acids)
In genomic island -

Contig

Accession contig_2
Length 292399 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_47
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Domains

PF04073 Aminoacyl-tRNA editing domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2606 Translation, ribosomal structure and biogenesis (J) J Cys-tRNA(Pro) deacylase, prolyl-tRNA editing enzyme YbaK/EbsC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19055 Ala-tRNA(Pro) deacylase [EC:3.1.1.-] - -

Protein Sequence

MSSSDNILRKITTLLDNHHARYEIMSHDALGFTSDEVAQVRGVELGQCSKAVVLKVKGNGVKKNVLAVLPGDEKIDGEKLAGFFGAKKISFATAEQVKTLTDCVPGALAPFTFNPELELVIDPVLFERYTDIAFNAGTLTETIVLNAEDYRTIVKPQEFSFIL

Flanking regions ( +/- flanking 50bp)

ATTTTTGATTACCGTGACCGGTAGTCAAAATAAGAAACAGGGAAAGCCGTATGTCTTCATCAGATAATATCCTCCGCAAAATCACCACCCTTCTGGATAATCACCATGCCCGCTATGAAATCATGAGCCATGATGCACTCGGTTTTACCTCTGATGAAGTGGCTCAGGTGCGCGGTGTTGAACTGGGGCAATGCTCCAAAGCCGTGGTGTTAAAAGTGAAAGGCAACGGCGTGAAGAAAAATGTGCTGGCGGTATTGCCCGGAGATGAAAAAATTGACGGCGAAAAACTGGCCGGTTTTTTCGGTGCTAAAAAGATTTCCTTTGCCACCGCTGAACAGGTGAAAACACTGACTGATTGTGTCCCCGGGGCACTGGCACCCTTTACATTTAATCCGGAACTGGAGCTGGTGATTGACCCGGTTCTGTTTGAACGCTACACCGATATCGCCTTCAATGCCGGAACACTGACAGAAACCATTGTGCTGAATGCAGAGGATTACCGGACGATTGTGAAACCACAGGAGTTCAGTTTTATTCTGTGATACGTTTCAACAACCACTAGCGAAAATTACAGTAAAATCAAACAATAAGT