Homologs in group_540

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_00290 EHELCC_00290 100.0 Morganella morganii S2 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
NLDBIP_03170 NLDBIP_03170 100.0 Morganella morganii S4 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
LHKJJB_04685 LHKJJB_04685 100.0 Morganella morganii S3 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
HKOGLL_02360 HKOGLL_02360 100.0 Morganella morganii S5 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
F4V73_RS07295 F4V73_RS07295 86.3 Morganella psychrotolerans - TetR/AcrR family transcriptional regulator
PMI_RS06060 PMI_RS06060 59.7 Proteus mirabilis HI4320 - TetR/AcrR family transcriptional regulator

Distribution of the homologs in the orthogroup group_540

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_540

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A0R4Z6 4.37e-10 60 35 1 77 1 kstR2 HTH-type transcriptional repressor KstR2 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WMB9 4.95e-10 59 36 0 71 1 kstR2 HTH-type transcriptional repressor KstR2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMB8 4.95e-10 59 36 0 71 3 kstR2 HTH-type transcriptional repressor KstR2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O08335 1.25e-06 50 40 0 61 4 fatR HTH-type transcriptional repressor FatR Bacillus subtilis (strain 168)
Q0S7V2 2.02e-06 49 40 0 57 1 kstR2 HTH-type transcriptional repressor KstR2 Rhodococcus jostii (strain RHA1)
O31560 4.81e-06 48 27 6 166 1 yfiR Uncharacterized HTH-type transcriptional regulator YfiR Bacillus subtilis (strain 168)
O07001 1.07e-05 47 34 1 73 1 yvdT Uncharacterized HTH-type transcriptional regulator YvdT Bacillus subtilis (strain 168)
P94548 1.67e-05 47 32 1 82 1 fadR Fatty acid metabolism regulator protein Bacillus subtilis (strain 168)
Q79ZV4 3.87e-05 45 40 0 47 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain MW2)
Q6G609 3.87e-05 45 40 0 47 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain MSSA476)
Q6GDD9 3.87e-05 45 40 0 47 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain MRSA252)
Q7A352 3.87e-05 45 40 0 47 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain N315)
Q7A2K5 3.87e-05 45 40 0 47 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QKF4 3.87e-05 45 40 0 47 1 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain Newman)
Q5HCN2 3.87e-05 45 40 0 47 1 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain COL)
Q9RQQ0 3.87e-05 45 40 0 47 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q0B713 6.44e-05 45 28 4 127 3 betI HTH-type transcriptional regulator BetI Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1Z032 6.44e-05 45 28 4 127 3 betI HTH-type transcriptional regulator BetI Burkholderia ambifaria (strain MC40-6)
P43506 8.22e-05 45 34 1 73 1 bm3R1 HTH-type transcriptional repressor Bm3R1 Priestia megaterium
Q8G2M8 9.38e-05 45 38 0 50 1 bepR HTH-type transcriptional repressor BepR Brucella suis biovar 1 (strain 1330)
P39897 0.000104 45 29 7 151 1 mtrR HTH-type transcriptional regulator MtrR Neisseria gonorrhoeae
B7N8L5 0.000139 44 29 0 92 3 betI HTH-type transcriptional regulator BetI Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P96676 0.000155 44 43 1 57 4 ydeS Uncharacterized HTH-type transcriptional regulator YdeS Bacillus subtilis (strain 168)
P28815 0.000187 44 39 0 46 1 tetC Transposon Tn10 TetC protein Escherichia coli
P75952 0.000328 43 30 0 71 1 comR HTH-type transcriptional repressor ComR Escherichia coli (strain K12)
A4JJG4 0.000398 43 31 2 90 3 betI HTH-type transcriptional regulator BetI Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q9RAJ1 0.000422 43 32 1 65 4 dhaR HTH-type transcriptional repressor DhaR Mycobacterium sp. (strain GP1)
Q66D52 0.000456 43 31 2 90 3 betI HTH-type transcriptional regulator BetI Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNP0 0.000456 43 31 2 90 3 betI HTH-type transcriptional regulator BetI Yersinia pestis (strain Pestoides F)
Q1CFR9 0.000456 43 31 2 90 3 betI HTH-type transcriptional regulator BetI Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZGV8 0.000456 43 31 2 90 3 betI HTH-type transcriptional regulator BetI Yersinia pestis
B2K8U6 0.000456 43 31 2 90 3 betI HTH-type transcriptional regulator BetI Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C930 0.000456 43 31 2 90 3 betI HTH-type transcriptional regulator BetI Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKL4 0.000456 43 31 2 90 3 betI HTH-type transcriptional regulator BetI Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1BQE0 0.000526 42 27 4 127 3 betI HTH-type transcriptional regulator BetI Burkholderia orbicola (strain AU 1054)
B1K709 0.000526 42 27 4 127 3 betI HTH-type transcriptional regulator BetI Burkholderia orbicola (strain MC0-3)
A0B2F5 0.000526 42 27 4 127 3 betI HTH-type transcriptional regulator BetI Burkholderia cenocepacia (strain HI2424)
B4EHJ0 0.000536 42 27 4 127 3 betI HTH-type transcriptional regulator BetI Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q8GLC6 0.000582 42 31 0 58 3 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus epidermidis
Q3J6K8 0.000588 42 35 2 90 1 acuR Transcriptional regulator AcuR Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
B1LIJ9 0.000589 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain SMS-3-5 / SECEC)
B5Z1R2 0.000612 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X6C3 0.000612 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Escherichia coli O157:H7
Q5HKQ1 0.000617 42 31 0 58 1 icaR Biofilm operon icaADBC HTH-type negative transcriptional regulator IcaR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B7NK49 0.00063 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q0T7M8 0.000699 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Shigella flexneri serotype 5b (strain 8401)
A7ZWV6 0.000699 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Escherichia coli O9:H4 (strain HS)
B7L442 0.000699 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain 55989 / EAEC)
A7ZI52 0.000699 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Escherichia coli O139:H28 (strain E24377A / ETEC)
B6I093 0.000741 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain SE11)
Q0TKV9 0.000741 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7M2V7 0.000741 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Escherichia coli O8 (strain IAI1)
Q1RFM1 0.000777 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain UTI89 / UPEC)
B7MCD2 0.000777 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Escherichia coli O45:K1 (strain S88 / ExPEC)
Q39A42 0.000779 42 27 4 127 3 betI HTH-type transcriptional regulator BetI Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8FKI7 0.0008 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7UJG6 0.0008 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P17446 0.000823 42 29 0 89 2 betI HTH-type transcriptional regulator BetI Escherichia coli (strain K12)
B1J0W4 0.000823 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XET8 0.000823 42 29 0 89 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain K12 / DH10B)
B2JS87 0.001 42 29 1 87 3 betI HTH-type transcriptional regulator BetI Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_01255
Feature type CDS
Gene acrR
Product DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
Location 241674 - 242267 (strand: 1)
Length 594 (nucleotides) / 197 (amino acids)

Contig

Accession contig_1
Length 309072 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_540
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00440 Bacterial regulatory proteins, tetR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1309 Transcription (K) K DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Protein Sequence

MTQSAEHKPRFKPADVRINELMDAAESLFLEKGFDATTVSDIVARAGVAKGTYYHYFAAKPDIYEALRHRYMDWFLSQTQQAMDACAAGDADARLAAWCDRSVTAYTEKQELHDVLFHQGFHQQGNDHENAVLNQLLALIAEGEKHSHWRVAHPDITAMIIYHGMHAAVDTLPQSGHYTAQTLGGVLYEQFLRFLKA

Flanking regions ( +/- flanking 50bp)

ATACCCCGGAAATGGCATAATGAGGGTTTTCCGTTATACAAGGCACGTTTATGACTCAGTCAGCAGAACACAAACCCCGTTTTAAACCTGCCGATGTCCGGATCAATGAACTGATGGATGCCGCCGAATCACTGTTTCTCGAAAAGGGATTTGATGCCACTACGGTCAGTGACATTGTGGCGCGGGCCGGTGTCGCCAAGGGAACCTATTACCACTATTTTGCCGCCAAACCGGACATTTACGAGGCATTACGCCACCGTTATATGGACTGGTTTCTGTCACAGACTCAGCAGGCGATGGATGCCTGTGCGGCAGGTGATGCGGATGCCAGACTGGCAGCCTGGTGTGATCGTTCTGTCACGGCCTATACTGAAAAACAGGAACTGCATGATGTCCTGTTCCATCAGGGATTTCACCAGCAGGGCAATGACCATGAAAATGCCGTGCTGAATCAGCTGCTTGCCCTGATTGCGGAAGGTGAGAAGCACAGTCACTGGCGGGTGGCACATCCGGATATCACGGCCATGATTATTTATCACGGTATGCATGCGGCGGTGGATACCCTGCCGCAGTCCGGACACTACACCGCACAGACGCTGGGCGGCGTGCTGTATGAACAGTTTCTGCGCTTTCTGAAGGCCTGATCTGCTCTGATAAAAAAAGCCCGGTCGCAGCCGGGCTTTGCACACTCTGT