Homologs in group_3704

Help

2 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20375 FBDBKF_20375 43.6 Morganella morganii S1 ompA OmpA family protein
F4V73_RS16850 F4V73_RS16850 29.0 Morganella psychrotolerans - OmpA family protein

Distribution of the homologs in the orthogroup group_3704

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3704

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
I2BAK7 1.64e-25 103 43 3 127 3 ompA Outer membrane protein A Shimwellia blattae (strain ATCC 29907 / DSM 4481 / JCM 1650 / NBRC 105725 / CDC 9005-74)
P09146 2.56e-25 102 43 3 127 3 ompA Outer membrane protein A Klebsiella aerogenes
P0DJO6 1.1e-24 99 43 3 124 3 ompA Outer membrane protein A (Fragment) Shimwellia blattae
P02936 7.89e-23 96 40 3 127 3 ompA Outer membrane protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z7S0 8.14e-23 96 40 3 127 3 ompA Outer membrane protein A Salmonella typhi
B7LNW7 3.49e-22 94 39 3 127 3 ompA Outer membrane protein A Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P02935 3.53e-22 94 39 3 127 3 ompA Outer membrane protein A Shigella dysenteriae
P0A910 3.54e-22 94 39 3 127 1 ompA Outer membrane protein A Escherichia coli (strain K12)
P0A911 3.54e-22 94 39 3 127 3 ompA Outer membrane protein A Escherichia coli O157:H7
A0A2S4N3N0 3.7e-22 94 39 3 127 1 ompA Outer membrane protein A Shigella flexneri
P24017 5.22e-22 94 40 3 127 1 ompA Outer membrane protein A Klebsiella pneumoniae
P24754 1.89e-21 90 39 3 124 3 ompA Outer membrane protein A (Fragment) Atlantibacter hermannii
P24016 3.83e-21 89 38 3 124 3 ompA Outer membrane protein A (Fragment) Citrobacter freundii
P38399 8.02e-21 90 32 4 155 1 ompA Outer membrane protein A Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZG77 8.02e-21 90 32 4 155 1 ompA Outer membrane protein A Yersinia pestis
P0C8Z2 8.6e-21 89 38 3 124 3 ompA Outer membrane protein A (Fragment) Escherichia fergusonii
P38368 1.42e-19 87 33 5 138 1 ompA Outer membrane protein P5 Haemophilus influenzae
P43840 4.1e-19 86 32 5 138 3 ompA Outer membrane protein P5 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P04845 4.58e-19 85 37 4 135 3 ompA Outer membrane protein A Serratia marcescens
P45996 8.3e-19 85 33 4 127 1 ompA Outer membrane protein P5 Haemophilus influenzae
P07050 3.67e-15 73 34 7 161 3 None Outer membrane protein P.III Neisseria gonorrhoeae
P57414 4.83e-15 74 34 4 122 3 ompA Outer membrane protein A Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8K9L4 5.94e-15 74 33 3 116 3 ompA Outer membrane protein A Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P24755 3.17e-14 71 36 3 125 3 ompA Outer membrane protein A (Fragment) Serratia odorifera
P0A0V3 3.06e-13 68 33 5 147 1 rmpM Outer membrane protein class 4 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0V2 1.05e-12 67 33 4 139 3 rmpM Outer membrane protein class 4 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q05146 2.62e-12 65 31 6 145 3 ompA Outer membrane protein A Bordetella avium
A0A160PB22 2.98e-12 66 35 2 116 1 tpgA Trimeric autotransporter adhesin- and peptidoglycan-associated protein A Acinetobacter sp. (strain Tol 5)
Q9I4L6 2.22e-07 51 28 7 145 1 yfiB Outer-membrane lipoprotein YfiB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P13794 2.55e-07 52 32 5 120 1 oprF Outer membrane porin F Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q89AJ5 5.9e-07 50 37 4 87 3 pal Peptidoglycan-associated lipoprotein Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9I4Z4 6.42e-07 50 32 3 99 3 pal Peptidoglycan-associated lipoprotein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7NFT5 1.99e-06 50 27 4 140 1 psaB Photosystem I P700 chlorophyll a apoprotein A2 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
P22263 2.94e-06 49 31 7 120 3 oprF Outer membrane porin F Pseudomonas syringae pv. syringae
P0A139 5.7e-06 47 33 6 124 3 pal Peptidoglycan-associated lipoprotein Pseudomonas putida
P0A138 5.7e-06 47 33 6 124 3 pal Peptidoglycan-associated lipoprotein Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P0A3S8 8.13e-06 47 34 2 70 1 pal Peptidoglycan-associated lipoprotein Brucella suis biovar 1 (strain 1330)
P0A3S7 8.13e-06 47 34 2 70 1 pal Peptidoglycan-associated lipoprotein Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P0A3S9 8.13e-06 47 34 2 70 1 pal Peptidoglycan-associated lipoprotein Brucella abortus biovar 1 (strain 9-941)
P26493 1.65e-05 46 27 4 97 3 pal Peptidoglycan-associated lipoprotein Legionella pneumophila
P0A914 3.6e-05 45 26 3 96 3 pal Peptidoglycan-associated lipoprotein Shigella flexneri
P0A912 3.6e-05 45 26 3 96 1 pal Peptidoglycan-associated lipoprotein Escherichia coli (strain K12)
P0A913 3.6e-05 45 26 3 96 3 pal Peptidoglycan-associated lipoprotein Escherichia coli O157:H7
P07021 4.31e-05 45 26 4 133 3 yfiB Putative lipoprotein YfiB Escherichia coli (strain K12)
P37726 7.65e-05 45 27 5 109 1 oprF Outer membrane porin F Pseudomonas fluorescens

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS19125
Feature type CDS
Gene -
Product OmpA family protein
Location 2999 - 3532 (strand: 1)
Length 534 (nucleotides) / 177 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000012
Length 10864 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3704
Orthogroup size 3
N. genomes 2

Actions

Genomic region

Domains

PF00691 OmpA family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2885 Cell wall/membrane/envelope biogenesis (M) M Outer membrane protein OmpA and related peptidoglycan-associated (lipo)proteins

Protein Sequence

MKKNYLIVSIASLFLTACAGNSTHRWCPPTKVTEQELSAPVVYEEIAIELSADTLFKFNKSSINDLLPNGKKELDNVVTQLMSSHINVKQIDITGHTDRLGSEQYNYKLGMQRAETIRNYLKNNGINNNINISSQGNSQPVTTSCNDVNSKAMLIACLQPDRRVTLNIIGVKDIQIN

Flanking regions ( +/- flanking 50bp)

AAATATATGTCAATTTGGATTTAGGCCAATATATATTTATAGGACATAAAATGAAAAAAAATTATTTAATTGTATCTATTGCATCACTATTTTTAACAGCTTGTGCAGGTAATTCTACTCATCGCTGGTGCCCTCCGACAAAAGTTACTGAGCAAGAATTGTCAGCACCTGTGGTATATGAAGAAATAGCGATTGAGTTGTCTGCAGATACATTATTTAAATTTAATAAATCAAGTATTAATGACTTATTACCTAACGGTAAGAAAGAATTAGATAATGTAGTTACACAATTAATGAGTAGCCATATAAATGTTAAGCAAATTGATATTACGGGTCATACAGATCGTTTAGGCTCTGAACAATACAATTACAAATTGGGTATGCAGAGAGCTGAAACAATACGTAACTATCTAAAAAATAATGGAATTAATAATAATATAAATATCTCTAGTCAAGGTAACTCTCAACCAGTAACCACATCTTGTAATGATGTAAATAGTAAAGCAATGCTTATAGCATGCTTACAACCTGATCGTCGAGTAACTTTAAATATTATTGGTGTAAAAGACATACAAATTAATTAAGTGCATATATATAAGGGGGCCTACACTGCTCCCTATTTTTTTATAATGGG