Homologs in group_216

Help

8 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16940 FBDBKF_16940 94.4 Morganella morganii S1 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
EHELCC_16650 EHELCC_16650 94.4 Morganella morganii S2 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
NLDBIP_16860 NLDBIP_16860 94.4 Morganella morganii S4 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
LHKJJB_16610 LHKJJB_16610 94.4 Morganella morganii S3 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
HKOGLL_17575 HKOGLL_17575 94.4 Morganella morganii S5 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
PMI_RS03975 PMI_RS03975 26.1 Proteus mirabilis HI4320 - class I SAM-dependent methyltransferase
PMI_RS14575 PMI_RS14575 31.6 Proteus mirabilis HI4320 - class I SAM-dependent methyltransferase
PMI_RS17575 PMI_RS17575 84.9 Proteus mirabilis HI4320 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE

Distribution of the homologs in the orthogroup group_216

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_216

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EWC9 1.62e-164 457 84 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Proteus mirabilis (strain HI4320)
B1JP75 1e-157 441 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FT0 1e-157 441 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TR39 1e-157 441 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis (strain Pestoides F)
Q1CNB4 1e-157 441 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis bv. Antiqua (strain Nepal516)
A9R431 1e-157 441 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis bv. Antiqua (strain Angola)
Q8D1I3 1e-157 441 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis
B2K0Y4 1e-157 441 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FDE0 1e-157 441 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8G8B8 1.06e-157 440 82 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Serratia proteamaculans (strain 568)
Q1CBG0 5.97e-157 438 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis bv. Antiqua (strain Antiqua)
A1JIF2 1.69e-156 437 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7MZ81 5.47e-156 436 82 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P0A2K5 2.4e-153 429 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2K6 2.4e-153 429 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella typhi
B4TNX9 2.4e-153 429 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella schwarzengrund (strain CVM19633)
B5BIX9 2.4e-153 429 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella paratyphi A (strain AKU_12601)
C0Q3E1 2.4e-153 429 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella paratyphi C (strain RKS4594)
A9MY97 2.4e-153 429 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKP4 2.4e-153 429 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SZ73 2.4e-153 429 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella newport (strain SL254)
B4TBR3 2.4e-153 429 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella heidelberg (strain SL476)
B5RFM8 2.4e-153 429 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QW73 2.4e-153 429 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella enteritidis PT4 (strain P125109)
B5FNW6 2.4e-153 429 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella dublin (strain CT_02021853)
Q57HN8 2.4e-153 429 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella choleraesuis (strain SC-B67)
B5EZU8 2.4e-153 429 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella agona (strain SL483)
Q3YVD2 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella sonnei (strain Ss046)
P0A889 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella flexneri
Q0SZ25 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella flexneri serotype 5b (strain 8401)
Q32A11 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella dysenteriae serotype 1 (strain Sd197)
Q31UF3 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella boydii serotype 4 (strain Sb227)
B2TVI4 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LM21 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain SMS-3-5 / SECEC)
B6I4H5 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain SE11)
B7NFD6 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A887 8.39e-153 428 79 0 251 1 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain K12)
B1IW72 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A6U0 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O9:H4 (strain HS)
B1XAJ7 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain K12 / DH10B)
C5A009 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain K12 / MC4100 / BW2952)
B7M638 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O8 (strain IAI1)
B7NV33 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YY82 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A888 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O157:H7
B7L996 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain 55989 / EAEC)
B7UNG3 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZU40 8.39e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LU01 9.06e-153 428 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q6DAQ7 1.33e-152 427 81 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MQL7 1.34e-152 427 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cronobacter sakazakii (strain ATCC BAA-894)
Q1R477 1.47e-152 427 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain UTI89 / UPEC)
Q8FBJ0 1.47e-152 427 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAM1 1.47e-152 427 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AI22 1.47e-152 427 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O1:K1 / APEC
B7N2E1 1.47e-152 427 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O81 (strain ED1a)
B7MHC0 1.47e-152 427 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O45:K1 (strain S88 / ExPEC)
A9MIY3 1.93e-152 427 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8ACY2 1.93e-152 427 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B2VG41 2.04e-152 427 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4WFY5 2.22e-152 427 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Enterobacter sp. (strain 638)
C6DI77 1.13e-151 425 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B5XYI1 5.17e-151 423 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Klebsiella pneumoniae (strain 342)
A6TGL3 2.15e-150 422 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q9CKD6 4.97e-148 417 76 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pasteurella multocida (strain Pm70)
C5BCA4 1.56e-146 412 76 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Edwardsiella ictaluri (strain 93-146)
C3LPS5 2.87e-146 412 76 0 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain M66-2)
Q9KVQ6 2.87e-146 412 76 0 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4E5 2.87e-146 412 76 0 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P59911 6.79e-146 411 75 0 250 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7MQ33 2.3e-145 409 77 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio vulnificus (strain YJ016)
Q8DDP9 2.3e-145 409 77 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio vulnificus (strain CMCP6)
Q87TH4 6.71e-145 408 79 0 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MTX1 1.01e-143 405 77 0 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio campbellii (strain ATCC BAA-1116)
A8H966 1.46e-136 387 71 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A8G0S7 1.9e-136 387 71 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sediminis (strain HAW-EB3)
Q5QYG2 3.11e-136 386 70 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A3QIE1 5.26e-136 385 71 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q3IJV7 7.08e-136 385 70 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudoalteromonas translucida (strain TAC 125)
B0TJ16 1.47e-135 384 70 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella halifaxensis (strain HAW-EB4)
B1KR07 2.75e-135 384 71 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella woodyi (strain ATCC 51908 / MS32)
A1SRS4 7.46e-135 382 69 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A6VTA1 2.81e-134 381 71 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Marinomonas sp. (strain MWYL1)
B8CI06 1.12e-133 380 70 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella piezotolerans (strain WP3 / JCM 13877)
Q12S23 3.27e-133 379 70 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q0HZP7 1.84e-131 374 70 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain MR-7)
Q0HEA1 1.84e-131 374 70 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain MR-4)
A0L1M4 1.84e-131 374 70 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain ANA-3)
A1SAJ8 7.32e-131 372 69 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q8E9R7 7.73e-131 372 70 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9KYL8 3.83e-130 370 69 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS195)
A6WIE9 3.83e-130 370 69 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS185)
A3D9F2 3.83e-130 370 69 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E6B6 8.15e-130 370 69 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS223)
A1RP78 1.66e-129 369 69 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain W3-18-1)
A4Y2Q5 1.66e-129 369 69 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B2SFA2 3.41e-128 366 71 0 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. mediasiatica (strain FSC147)
A0Q549 1.51e-127 364 71 0 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. novicida (strain U112)
Q088H8 2.42e-127 363 68 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella frigidimarina (strain NCIMB 400)
Q9HUC0 2.43e-127 364 71 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02EV4 2.43e-127 364 71 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3F6 2.43e-127 364 71 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain LESB58)
A4IXH9 2.45e-127 363 71 0 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NFE1 3.11e-127 363 71 0 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14GU4 3.11e-127 363 71 0 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. tularensis (strain FSC 198)
Q0BNE2 3.32e-127 363 71 0 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. holarctica (strain OSU18)
Q2A524 3.32e-127 363 71 0 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. holarctica (strain LVS)
A7NAA1 3.32e-127 363 71 0 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
C5BRL2 4.76e-127 363 72 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Teredinibacter turnerae (strain ATCC 39867 / T7901)
B0TZP1 1.02e-126 362 71 0 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A4VGE5 4.98e-126 360 70 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Stutzerimonas stutzeri (strain A1501)
B1J2S8 4.4e-125 358 66 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida (strain W619)
Q88D17 1.79e-124 357 68 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WA45 1.79e-124 357 68 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
C1DHS2 2.61e-124 356 68 0 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B0KM36 3.3e-124 356 68 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida (strain GB-1)
Q1I3T0 7.59e-124 355 66 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas entomophila (strain L48)
Q9Z439 9.76e-124 355 68 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida
C3K8U4 1.46e-123 354 68 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas fluorescens (strain SBW25)
Q3KJC5 1.15e-122 352 68 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas fluorescens (strain Pf0-1)
A4XPM7 5.86e-122 350 66 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas mendocina (strain ymp)
B3PH48 6.96e-122 350 70 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cellvibrio japonicus (strain Ueda107)
A6VDI6 7.38e-122 350 71 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain PA7)
Q87UZ2 1.87e-121 349 68 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZZG3 2.71e-121 348 68 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas syringae pv. syringae (strain B728a)
Q48PJ4 2.71e-121 348 68 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q21H69 7.65e-121 347 68 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q2SN12 1.07e-118 342 66 0 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Hahella chejuensis (strain KCTC 2396)
Q5X0X6 2.72e-111 323 63 0 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Legionella pneumophila (strain Paris)
Q5WSQ8 3.46e-111 323 62 0 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Legionella pneumophila (strain Lens)
A5II90 5.48e-111 322 61 0 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Legionella pneumophila (strain Corby)
Q5ZRH9 3.56e-110 320 62 0 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q31IM5 5.36e-110 320 61 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q7VRJ1 4.41e-108 315 60 0 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Blochmanniella floridana
Q491V7 9.37e-108 314 59 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Blochmanniella pennsylvanica (strain BPEN)
Q606J9 1.3e-107 313 61 0 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q7NZD3 2.82e-107 312 62 2 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A9N9F4 6.64e-106 309 57 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain RSA 331 / Henzerling II)
Q83A90 1.52e-105 308 57 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KD75 1.52e-105 308 57 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain Dugway 5J108-111)
B6J3P6 1.52e-105 308 57 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain CbuG_Q212)
Q9JV83 3.47e-105 307 60 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9K075 4.88e-105 307 60 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1KT06 1.47e-104 306 59 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
B6J676 1.88e-104 305 56 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain CbuK_Q154)
Q3SM81 4.02e-104 305 60 2 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Thiobacillus denitrificans (strain ATCC 25259)
A9M3A0 6.17e-104 304 60 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria meningitidis serogroup C (strain 053442)
B4RK11 8.38e-104 304 59 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria gonorrhoeae (strain NCCP11945)
Q5F9R9 8.38e-104 304 59 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
C1DCV3 2.14e-103 303 60 2 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Laribacter hongkongensis (strain HLHK9)
Q1LRG9 2.52e-103 302 59 2 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B2AH07 2.08e-102 300 59 2 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q81ZZ8 2.25e-102 300 59 2 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q475X0 3.1e-101 297 58 2 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q2T139 9.98e-101 296 58 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63XA0 9.98e-101 296 58 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia pseudomallei (strain K96243)
A3N5U8 9.98e-101 296 58 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia pseudomallei (strain 668)
Q3JVZ6 9.98e-101 296 58 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia pseudomallei (strain 1710b)
A3NRJ4 9.98e-101 296 58 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia pseudomallei (strain 1106a)
A1V753 9.98e-101 296 58 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia mallei (strain SAVP1)
Q62MP4 9.98e-101 296 58 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia mallei (strain ATCC 23344)
A2S8L1 9.98e-101 296 58 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia mallei (strain NCTC 10229)
A3MNT8 9.98e-101 296 58 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia mallei (strain NCTC 10247)
Q8Y278 1.31e-100 295 58 2 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2UFG8 1.99e-100 295 57 2 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Ralstonia pickettii (strain 12J)
B2SX35 2.58e-100 295 58 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q0KEH6 3.01e-100 295 58 2 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B2JCU8 3.63e-100 295 58 2 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q0BBY4 6.27e-100 294 57 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YWF9 6.27e-100 294 57 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia ambifaria (strain MC40-6)
Q39D13 8.42e-100 293 57 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q145P0 1.21e-99 293 58 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Paraburkholderia xenovorans (strain LB400)
Q1BTN4 1.22e-99 293 57 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia orbicola (strain AU 1054)
A0KAF5 1.22e-99 293 57 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia cenocepacia (strain HI2424)
B1JYJ6 2.48e-99 292 57 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia orbicola (strain MC0-3)
B4EBC4 2.48e-99 292 57 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A9AFC0 2.96e-99 292 57 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia multivorans (strain ATCC 17616 / 249)
A4JHS6 1.12e-98 291 57 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q7W0H1 3.11e-98 290 54 2 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3N6 3.11e-98 290 54 2 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WF12 3.11e-98 290 54 2 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2KUG1 2.8e-97 288 56 2 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bordetella avium (strain 197N)
Q2Y6R0 3.26e-97 287 56 2 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q8P558 6.26e-97 286 57 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q87DI1 7.7e-97 286 56 0 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2IA21 7.7e-97 286 56 0 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xylella fastidiosa (strain M23)
Q8PPP2 3.48e-96 285 57 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xanthomonas axonopodis pv. citri (strain 306)
B0U6V1 4.01e-96 285 56 0 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xylella fastidiosa (strain M12)
Q2NYW4 7.56e-96 284 56 0 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q9PD92 1.68e-95 283 56 0 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xylella fastidiosa (strain 9a5c)
B4SJ34 3.2e-95 282 55 0 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Stenotrophomonas maltophilia (strain R551-3)
B2FUU6 4.21e-94 280 55 0 241 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Stenotrophomonas maltophilia (strain K279a)
Q8D382 4.86e-92 274 49 0 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Wigglesworthia glossinidia brevipalpis
A6WYI0 1.9e-87 263 53 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A9MCZ2 4.07e-86 259 52 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q8YDE4 5e-86 259 52 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RMK3 5e-86 259 52 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella melitensis biotype 2 (strain ATCC 23457)
Q576Q0 5e-86 259 52 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella abortus biovar 1 (strain 9-941)
Q2YJM4 5e-86 259 52 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella abortus (strain 2308)
B2SC50 5e-86 259 52 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella abortus (strain S19)
Q8FUZ3 1.96e-85 258 51 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella suis biovar 1 (strain 1330)
A9WW74 1.03e-84 256 51 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella suis (strain ATCC 23445 / NCTC 10510)
A5FZ96 3.15e-81 246 48 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Acidiphilium cryptum (strain JF-5)
Q2KDB0 5.13e-81 246 49 1 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q1GC56 1.23e-80 245 49 1 250 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Ruegeria sp. (strain TM1040)
A9ILA7 1.09e-79 243 47 1 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bartonella tribocorum (strain CIP 105476 / IBS 506)
B5ZYK8 1.94e-79 242 48 1 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q16DL1 2.19e-79 242 47 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q1MME0 2.3e-79 242 48 1 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B3PZ92 3.64e-79 242 48 1 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhizobium etli (strain CIAT 652)
A8LNK7 1.19e-78 240 47 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B0T7D0 2.18e-78 239 48 2 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Caulobacter sp. (strain K31)
A1UUE1 2.48e-78 239 47 1 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B8GVY5 7.72e-78 238 46 2 253 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A258 7.72e-78 238 46 2 253 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9Z5E9 1.3e-77 234 69 0 155 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (Fragment) Pseudomonas oleovorans
A6UFF7 1.88e-77 237 48 1 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Sinorhizobium medicae (strain WSM419)
C3MCY6 6.44e-77 236 47 1 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q98GV1 1.59e-76 235 47 1 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A4WVR7 1.97e-76 234 47 1 250 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q54VN2 2.22e-76 236 45 5 270 3 coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Dictyostelium discoideum
Q92SK7 2.43e-76 234 48 1 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhizobium meliloti (strain 1021)
B9JZF4 3.16e-76 234 47 1 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q66L51 3.44e-76 236 44 2 274 2 coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Danio rerio
B9J7S8 4.06e-76 234 47 1 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q6G577 4.82e-76 234 45 1 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q6G1I2 7.7e-76 233 45 1 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bartonella quintana (strain Toulouse)
Q13EN8 1.47e-75 232 46 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhodopseudomonas palustris (strain BisB5)
Q8UIH5 2.34e-75 232 45 1 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9VYF8 3.34e-75 233 45 2 254 2 Coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Drosophila melanogaster
Q0P5A2 4.01e-75 234 42 1 283 2 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Bos taurus
B8IJ00 5.27e-75 231 48 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
B4RC42 5.69e-75 231 48 2 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Phenylobacterium zucineum (strain HLK1)
B9KQJ8 1.93e-74 229 46 1 250 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3IY65 1.93e-74 229 46 1 250 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PFL1 1.93e-74 229 46 1 250 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A4YJH0 3.66e-74 229 45 1 252 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bradyrhizobium sp. (strain ORS 278)
A5E888 3.74e-74 229 45 1 252 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q89WD0 6.1e-74 228 45 1 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q4G064 7.58e-74 231 44 3 284 2 Coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Rattus norvegicus
Q5HYK3 1.18e-73 230 42 1 283 1 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Homo sapiens
Q2J2H9 1.34e-73 227 46 1 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhodopseudomonas palustris (strain HaA2)
A8GPI0 2.1e-73 227 44 3 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia akari (strain Hartford)
Q1QS47 2.33e-73 227 45 1 252 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A1BAN1 4.54e-73 226 48 2 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Paracoccus denitrificans (strain Pd 1222)
Q5RBK6 1.43e-72 227 43 3 284 2 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Pongo abelii
Q4UMW4 1.95e-72 224 44 3 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9CXI0 1.23e-71 225 43 3 284 1 Coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Mus musculus
Q4V7R3 1.42e-71 224 41 2 283 2 coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Xenopus laevis
Q1RJY5 1.99e-71 222 42 3 249 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia bellii (strain RML369-C)
B3Q619 6.83e-71 220 45 1 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhodopseudomonas palustris (strain TIE-1)
Q6NDM2 6.83e-71 220 45 1 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A8GXR2 9.22e-71 220 42 3 249 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia bellii (strain OSU 85-389)
A8F2G9 1.04e-69 217 43 3 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia massiliae (strain Mtu5)
A8GT99 1.09e-69 217 43 3 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia rickettsii (strain Sheila Smith)
B0BUT9 1.09e-69 217 43 3 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia rickettsii (strain Iowa)
Q92GT5 1.13e-69 217 43 3 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia conorii (strain ATCC VR-613 / Malish 7)
C3PLF4 1.18e-69 217 43 3 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia africae (strain ESF-5)
Q5ZLL5 1.69e-69 219 42 2 276 2 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Gallus gallus
Q9ZCP3 2.14e-69 216 42 3 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia prowazekii (strain Madrid E)
C4K2K3 4.55e-68 213 43 3 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia peacockii (strain Rustic)
Q68W57 1.17e-67 212 43 3 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A8EZP4 2.7e-67 211 42 3 250 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia canadensis (strain McKiel)
P34666 3.13e-67 212 43 3 245 3 coq-5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Caenorhabditis elegans
C0R2Q3 3.98e-66 208 45 4 239 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73HZ4 5.41e-65 205 44 4 239 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Wolbachia pipientis wMel
Q5JNC0 1.6e-63 203 41 3 258 2 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Oryza sativa subsp. japonica
Q9X3X2 2.75e-63 201 42 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
P55905 6.9e-63 201 44 4 243 2 None 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Leishmania donovani
Q9XAP8 1.11e-62 199 43 4 237 3 menG Demethylmenaquinone methyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9LVC8 3.29e-62 199 40 2 258 2 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Arabidopsis thaliana
Q9JPD1 1.95e-61 196 42 3 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rubrivivax gelatinosus (strain NBRC 100245 / IL144)
Q81ZX2 2.57e-60 192 42 3 226 3 menG Demethylmenaquinone methyltransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B2HRQ2 4.1e-60 192 45 2 226 3 menG Demethylmenaquinone methyltransferase Mycobacterium marinum (strain ATCC BAA-535 / M)
A0PLV5 1.32e-59 191 45 2 226 3 menG Demethylmenaquinone methyltransferase Mycobacterium ulcerans (strain Agy99)
P9WFR3 8.79e-59 189 44 2 226 1 menG Demethylmenaquinone methyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFR2 8.79e-59 189 44 2 226 3 menG Demethylmenaquinone methyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5TZT8 8.79e-59 189 44 2 226 3 menG Demethylmenaquinone methyltransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AKN8 8.79e-59 189 44 2 226 3 menG Demethylmenaquinone methyltransferase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KG35 8.79e-59 189 44 2 226 3 menG Demethylmenaquinone methyltransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A639 8.79e-59 189 44 2 226 3 menG Demethylmenaquinone methyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q1BE01 1.44e-58 188 43 3 236 3 menG Demethylmenaquinone methyltransferase Mycobacterium sp. (strain MCS)
A1UAY5 1.44e-58 188 43 3 236 3 menG Demethylmenaquinone methyltransferase Mycobacterium sp. (strain KMS)
Q5YPB0 1.83e-58 188 43 2 227 3 menG Demethylmenaquinone methyltransferase Nocardia farcinica (strain IFM 10152)
A9WRT1 2.2e-58 188 43 3 227 3 menG Demethylmenaquinone methyltransferase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
A3PUJ1 4.98e-58 187 42 3 236 3 menG Demethylmenaquinone methyltransferase Mycobacterium sp. (strain JLS)
A1R990 9.75e-58 187 42 3 227 3 menG Demethylmenaquinone methyltransferase Paenarthrobacter aurescens (strain TC1)
C4LL93 1.11e-57 186 43 3 236 3 menG Demethylmenaquinone methyltransferase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
P87230 1.38e-57 188 40 6 263 3 coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O66128 2.01e-57 186 36 1 237 3 menG Demethylmenaquinone methyltransferase Micrococcus luteus
B9DNV5 1.2e-56 184 38 2 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus carnosus (strain TM300)
B0RCZ0 2.31e-56 183 41 2 232 3 menG Demethylmenaquinone methyltransferase Clavibacter sepedonicus
Q73SL8 2.55e-56 182 43 2 226 3 menG Demethylmenaquinone methyltransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q2YY85 3.71e-56 182 40 2 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
P67063 4.42e-56 182 40 2 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain MW2)
A8Z450 4.42e-56 182 40 2 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G992 4.42e-56 182 40 2 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain MSSA476)
P67062 4.42e-56 182 40 2 234 1 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain N315)
P67061 4.42e-56 182 40 2 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QH20 4.42e-56 182 40 2 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain Newman)
Q5HFV2 4.42e-56 182 40 2 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain COL)
A5ISZ9 4.42e-56 182 40 2 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain JH9)
A6U1T9 4.42e-56 182 40 2 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain JH1)
A7X2H6 4.42e-56 182 40 2 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
B1MHC3 5.15e-56 182 43 3 232 3 menG Demethylmenaquinone methyltransferase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A0AK43 6.33e-56 182 39 1 230 3 menG Demethylmenaquinone methyltransferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P67055 1.17e-55 181 39 1 230 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71Y84 1.17e-55 181 39 1 230 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4b (strain F2365)
C1KWN1 1.17e-55 181 39 1 230 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4b (strain CLIP80459)
P67056 1.17e-55 181 39 1 230 3 menG Demethylmenaquinone methyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
C5C0T0 1.87e-55 181 42 2 227 3 menG Demethylmenaquinone methyltransferase Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q8CSH9 2.13e-55 181 37 2 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HP74 2.13e-55 181 37 2 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B8DBZ5 2.55e-55 180 39 1 230 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4a (strain HCC23)
Q6GGU0 3.57e-55 180 39 2 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain MRSA252)
Q4L6H3 8.46e-55 179 37 2 236 3 menG Demethylmenaquinone methyltransferase Staphylococcus haemolyticus (strain JCSC1435)
B1W525 9.34e-55 178 40 2 226 3 menG Demethylmenaquinone methyltransferase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
A1SE26 4.31e-54 177 40 2 226 3 menG Demethylmenaquinone methyltransferase Nocardioides sp. (strain ATCC BAA-499 / JS614)
A1T3S1 5.2e-54 176 42 2 226 3 menG Demethylmenaquinone methyltransferase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q8CWG0 7.18e-53 174 37 1 232 3 menG Demethylmenaquinone methyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q3A209 1.54e-52 173 39 4 236 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
C6E4U6 1.7e-52 173 38 1 232 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Geobacter sp. (strain M21)
A0QRH1 1.87e-52 172 42 2 226 3 menG Demethylmenaquinone methyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q49XS5 1.97e-52 172 35 2 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9CBA8 1.99e-52 172 42 2 226 3 menG Demethylmenaquinone methyltransferase Mycobacterium leprae (strain TN)
Q5WGT4 1.01e-51 171 38 1 230 3 menG Demethylmenaquinone methyltransferase Shouchella clausii (strain KSM-K16)
Q74EU2 1.03e-51 171 35 1 232 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B5EFL1 1.36e-51 171 37 1 232 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
P59912 2.03e-51 172 36 3 234 3 menG Demethylmenaquinone methyltransferase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A4T183 2.17e-51 170 42 2 226 3 menG Demethylmenaquinone methyltransferase Mycolicibacterium gilvum (strain PYR-GCK)
B7GHP8 2.32e-51 170 38 1 233 3 menG Demethylmenaquinone methyltransferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
C3PKL1 3.83e-51 169 41 2 226 3 menG Demethylmenaquinone methyltransferase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q5KXU0 1.56e-50 168 38 1 230 3 menG Demethylmenaquinone methyltransferase Geobacillus kaustophilus (strain HTA426)
P49017 1.9e-50 170 40 8 268 1 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P31113 2.96e-50 167 36 1 233 1 menG Demethylmenaquinone methyltransferase Bacillus subtilis (strain 168)
B9LZA9 3.65e-50 167 34 2 238 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q6MHQ3 7.6e-50 166 38 3 233 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
O86169 9.27e-50 166 37 1 233 3 menG Demethylmenaquinone methyltransferase Geobacillus stearothermophilus
A7GN50 1.08e-49 166 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q73AY2 1.28e-49 166 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q72HI4 1.57e-49 165 40 3 221 3 menG Demethylmenaquinone methyltransferase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q47LE2 3.29e-49 164 38 4 227 3 menG Demethylmenaquinone methyltransferase Thermobifida fusca (strain YX)
Q6HL42 3.5e-49 164 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63DL9 3.5e-49 164 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain ZK / E33L)
B9IVN5 3.5e-49 164 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain Q1)
B7HL23 3.5e-49 164 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain AH187)
C1EN10 3.5e-49 164 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain 03BB102)
B7JGZ8 3.5e-49 164 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain AH820)
Q81SW0 3.5e-49 164 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus anthracis
C3L8S6 3.5e-49 164 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P5A0 3.5e-49 164 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus anthracis (strain A0248)
B1HTA6 4.39e-49 164 37 1 226 3 menG Demethylmenaquinone methyltransferase Lysinibacillus sphaericus (strain C3-41)
Q81FQ6 6.77e-49 164 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HHR7 6.77e-49 164 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain B4264)
B7IP91 6.77e-49 164 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain G9842)
C5D3E5 7.54e-49 164 36 1 230 3 menG Demethylmenaquinone methyltransferase Geobacillus sp. (strain WCH70)
A4QBE5 9.59e-49 163 38 2 226 3 menG Demethylmenaquinone methyltransferase Corynebacterium glutamicum (strain R)
Q65I24 2.66e-48 162 36 1 230 3 menG Demethylmenaquinone methyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A5GA37 2.96e-48 162 33 2 238 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Geotalea uraniireducens (strain Rf4)
A7Z627 3.11e-48 162 35 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q64XV8 3.46e-48 162 33 1 234 3 menG Demethylmenaquinone methyltransferase Bacteroides fragilis (strain YCH46)
Q5LH04 3.46e-48 162 33 1 234 3 menG Demethylmenaquinone methyltransferase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q8NT39 3.51e-48 162 38 2 226 3 menG Demethylmenaquinone methyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A6L3D5 8.12e-48 161 33 2 238 3 menG Demethylmenaquinone methyltransferase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A9VMC2 2.39e-47 160 35 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus mycoides (strain KBAB4)
Q9KCC4 3.48e-47 159 36 1 230 3 menG Demethylmenaquinone methyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A8FEK9 4.66e-47 159 35 1 234 3 menG Demethylmenaquinone methyltransferase Bacillus pumilus (strain SAFR-032)
P94298 5.27e-47 159 35 1 230 3 menG Demethylmenaquinone methyltransferase Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
Q8A005 5.72e-47 159 33 1 231 3 menG Demethylmenaquinone methyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B1VEN4 6.91e-47 158 40 4 237 3 menG Demethylmenaquinone methyltransferase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
B2RJE9 1.24e-46 158 32 1 247 3 menG Demethylmenaquinone methyltransferase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q7MVR7 1.85e-46 158 32 0 234 3 menG Demethylmenaquinone methyltransferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q88SI6 3.36e-46 157 34 0 226 3 menG Demethylmenaquinone methyltransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8FSB3 1.06e-44 153 39 2 226 3 menG Demethylmenaquinone methyltransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q9RRT0 2.18e-44 152 35 3 234 3 menG Demethylmenaquinone methyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q24W96 3.8e-44 152 32 0 231 3 menG Demethylmenaquinone methyltransferase Desulfitobacterium hafniense (strain Y51)
P49016 5.11e-44 152 35 1 225 3 menG Demethylmenaquinone methyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
Q8DGE4 4.24e-43 148 35 3 227 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q74LY0 3.22e-41 144 34 3 230 3 menG Demethylmenaquinone methyltransferase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A8LCA4 7.5e-41 144 35 2 245 3 menG Demethylmenaquinone methyltransferase Parafrankia sp. (strain EAN1pec)
Q67LE6 3.35e-40 142 33 1 244 3 menG Demethylmenaquinone methyltransferase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P67064 6.63e-39 138 36 6 229 3 menG Demethylmenaquinone methyltransferase Tropheryma whipplei (strain Twist)
P67065 6.63e-39 138 36 6 229 3 menG Demethylmenaquinone methyltransferase Tropheryma whipplei (strain TW08/27)
Q3ED65 1.31e-38 138 32 4 245 1 MENG 2-phytyl-1,4-beta-naphthoquinone methyltransferase, chloroplastic Arabidopsis thaliana
Q5N4X9 3.5e-37 133 32 2 220 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31P90 3.5e-37 133 32 2 220 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A7NF26 6.71e-36 130 32 2 231 3 menG Demethylmenaquinone methyltransferase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q8EXJ3 8.79e-36 130 34 4 239 3 menG Demethylmenaquinone methyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q75FL1 8.79e-36 130 34 4 239 3 menG Demethylmenaquinone methyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A5UVB2 1.34e-35 129 32 4 232 3 menG Demethylmenaquinone methyltransferase Roseiflexus sp. (strain RS-1)
Q8YLP4 2.02e-35 129 30 1 218 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q6ANL3 4.17e-35 128 32 4 229 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q3MD91 3.54e-34 125 29 1 218 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B2IUM7 7.68e-33 122 30 2 222 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q9K2B6 1.12e-32 122 31 5 209 3 menG Demethylmenaquinone methyltransferase Chlamydia pneumoniae
Q6MCB5 1.63e-32 122 30 3 238 3 menG Demethylmenaquinone methyltransferase Protochlamydia amoebophila (strain UWE25)
Q8KF69 3.67e-32 120 29 4 243 3 menG Demethylmenaquinone methyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B3QLI9 1.34e-30 117 28 4 232 3 menG Demethylmenaquinone methyltransferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
P72818 2.16e-28 110 29 3 224 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q81ZV1 1.76e-27 108 28 5 218 3 menG Demethylmenaquinone methyltransferase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q9PJW4 1.97e-27 108 28 4 207 3 menG Demethylmenaquinone methyltransferase Chlamydia muridarum (strain MoPn / Nigg)
A8FKB3 2.8e-27 108 28 5 236 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q9WZL2 1.56e-26 105 31 7 234 3 menG Demethylmenaquinone methyltransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9PIH5 1.32e-25 103 28 5 236 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
O84435 2.24e-25 102 28 4 207 3 menG Demethylmenaquinone methyltransferase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KLS2 2.24e-25 102 28 4 207 3 menG Demethylmenaquinone methyltransferase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0BC65 2.38e-25 102 28 4 207 3 menG Demethylmenaquinone methyltransferase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B800 2.38e-25 102 28 4 207 3 menG Demethylmenaquinone methyltransferase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q5HWE7 2.9e-25 102 28 5 236 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Campylobacter jejuni (strain RM1221)
A1VY43 2.9e-25 102 28 5 236 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q253I8 1.19e-24 100 27 4 211 3 menG Demethylmenaquinone methyltransferase Chlamydia felis (strain Fe/C-56)
Q6N3Y0 2.8e-14 73 40 1 105 1 arsM Arsenite methyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
O31474 6.55e-13 69 33 2 119 1 ycgJ Uncharacterized methyltransferase YcgJ Bacillus subtilis (strain 168)
P64842 2.19e-12 68 30 3 118 3 BQ2027_MB1440C Uncharacterized protein Mb1440c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WLY7 2.19e-12 68 30 3 118 1 Rv1405c Uncharacterized protein Rv1405c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WLY6 2.19e-12 68 30 3 118 3 MT1449 Uncharacterized protein MT1449 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
C5BMZ8 1.96e-11 67 28 3 150 3 bioC Biotin biosynthesis bifunctional protein BioHC Teredinibacter turnerae (strain ATCC 39867 / T7901)
A0A0D3MJQ5 2.26e-11 65 30 4 173 1 arsM Arsenite methyltransferase Clostridium sp.
Q8TJK1 2.89e-11 65 36 1 108 1 arsM Arsenite methyltransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
P20187 3.67e-11 65 26 5 204 3 None Uncharacterized 37.1 kDa protein in transposon TN4556 Streptomyces fradiae
Q05197 5.2e-09 58 30 1 125 4 pmtA Phosphatidylethanolamine N-methyltransferase Cereibacter sphaeroides
P54458 1.25e-08 57 29 6 144 3 yqeM Putative methyltransferase YqeM Bacillus subtilis (strain 168)
Q8KZ94 1.56e-08 57 31 2 113 1 rebM Demethylrebeccamycin-D-glucose O-methyltransferase Lentzea aerocolonigenes
Q4WQZ0 2.02e-08 57 23 6 171 2 tpcH Methyltransferase tpcH Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A6W0X8 5.27e-08 55 24 3 159 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Marinomonas sp. (strain MWYL1)
O13871 6.13e-08 55 30 2 115 3 SPAC1B3.06c Uncharacterized methyltransferase C1B3.06c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q55423 6.79e-08 55 25 5 158 3 sll0829 Uncharacterized methyltransferase sll0829 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P64840 7.51e-08 55 27 3 118 3 BQ2027_MB1438C Uncharacterized protein Mb1438c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WLY9 7.51e-08 55 27 3 118 3 Rv1403c Uncharacterized protein Rv1403c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WLY8 7.51e-08 55 27 3 118 3 MT1447 Uncharacterized protein MT1447 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P46326 1.22e-07 54 23 1 112 3 yxbB Uncharacterized protein YxbB Bacillus subtilis (strain 168)
L0E172 1.27e-07 55 30 1 110 3 phqN Methyltransferase phqN Penicillium fellutanum
D8MPW4 1.35e-07 54 25 5 172 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Erwinia billingiae (strain Eb661)
P36571 1.4e-07 54 30 4 124 1 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Serratia marcescens
P30866 2.05e-07 53 34 1 84 3 yafE Uncharacterized protein YafE Escherichia coli (strain K12)
C3N8G6 2.22e-07 53 26 2 109 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
C3MTW8 2.22e-07 53 26 2 109 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C3MJI5 2.22e-07 53 26 2 109 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
C4KJM8 2.22e-07 53 26 2 109 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
C3N0H8 2.22e-07 53 26 2 109 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain M.16.27)
C3NJQ5 2.31e-07 53 26 2 109 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
Q9TYP1 2.86e-07 53 28 2 108 1 strm-1 Sterol 4-C-methyltransferase strm-1 Caenorhabditis elegans
H2E7T8 3.01e-07 54 22 4 181 2 SMT-1 Sterol methyltransferase-like 1 Botryococcus braunii
P96576 3.66e-07 52 25 3 118 3 ydaC Uncharacterized methyltransferase YdaC Bacillus subtilis (strain 168)
Q4X158 3.85e-07 53 26 3 119 1 tmtA Gliotoxin thiomethyltransferase GtmA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q9LM02 5.55e-07 53 24 4 178 1 SMT1 Cycloartenol-C-24-methyltransferase Arabidopsis thaliana
A0A0A2IBN3 5.84e-07 52 29 2 132 1 cnsE O-methyltransferase cnsE Penicillium expansum
B3PI89 6.3e-07 53 28 5 157 3 bioC Biotin biosynthesis bifunctional protein BioHC Cellvibrio japonicus (strain Ueda107)
Q1QDU2 7.16e-07 53 29 1 100 3 rlmD 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
O52025 8.02e-07 52 25 4 172 2 arsM Arsenite methyltransferase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
D2T333 8.57e-07 52 28 4 140 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96)
Q6ZIX2 9.31e-07 52 29 2 116 2 Smt1-1 Cycloartenol-C-24-methyltransferase 1 Oryza sativa subsp. japonica
A6UYW3 1.1e-06 52 28 3 122 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pseudomonas aeruginosa (strain PA7)
G0FUS0 1.27e-06 52 27 1 111 1 RAM_03320 27-O-demethylrifamycin SV methyltransferase Amycolatopsis mediterranei (strain S699)
Q4FUU5 1.32e-06 52 29 1 100 3 rlmD 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q609U9 1.75e-06 51 30 3 120 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q57060 1.85e-06 51 28 2 117 4 HI_0095 Uncharacterized protein HI_0095 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A1WVM4 2.25e-06 51 27 4 161 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Halorhodospira halophila (strain DSM 244 / SL1)
A0A1D6NER6 2.44e-06 51 24 7 210 2 PEAMT1 Phosphoethanolamine N-methyltransferase 1 Zea mays
Q944H0 2.91e-06 51 26 4 143 1 NMT2 Phosphoethanolamine N-methyltransferase 2 Arabidopsis thaliana
Q7CH67 3e-06 50 25 4 135 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Yersinia pestis
Q9FR44 3.43e-06 51 26 5 150 1 NMT1 Phosphoethanolamine N-methyltransferase 1 Arabidopsis thaliana
U2ZU49 4.78e-06 50 29 2 115 1 arsM Arsenite methyltransferase Pseudomonas alcaligenes (strain ATCC 14909 / DSM 50342 / JCM 20561 / NBRC 14159 / NCIMB 9945 / NCTC 10367 / 1577)
Q6C2D9 7.35e-06 50 27 1 112 3 ERG6 Sterol 24-C-methyltransferase Yarrowia lipolytica (strain CLIB 122 / E 150)
O06898 7.56e-06 49 27 5 151 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pseudescherichia vulneris
Q8EDK8 1.21e-05 48 30 5 141 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q96WX4 1.37e-05 49 23 1 113 1 erg6 Sterol 24-C-methyltransferase Pneumocystis carinii (strain B80)
Q4W9V1 1.45e-05 48 25 1 112 1 erg6 Sterol 24-C-methyltransferase erg6 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q9M571 1.53e-05 49 28 4 128 1 PEAMT Phosphoethanolamine N-methyltransferase Spinacia oleracea
Q759S7 1.6e-05 48 28 1 113 3 ERG6 Sterol 24-C-methyltransferase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q3K8T6 1.93e-05 48 26 8 190 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain Pf0-1)
Q0WPT7 2.12e-05 48 25 5 135 1 At2g41040 Uncharacterized methyltransferase At2g41040, chloroplastic Arabidopsis thaliana
C8YTM5 2.32e-05 48 27 5 153 1 PEAMT2 Phosphoethanolamine N-methyltransferase Triticum aestivum
Q6D3C1 2.64e-05 47 22 4 159 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B7V9J5 2.87e-05 47 23 6 187 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain LESB58)
Q9HZ63 2.92e-05 47 23 6 187 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4K8M4 3.15e-05 47 25 8 190 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q02PX7 3.18e-05 47 23 6 187 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q6ZLD3 3.81e-05 47 33 1 74 2 ARSM2 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase 1, chloroplastic Oryza sativa subsp. japonica
A0PQ29 4.27e-05 47 28 2 101 3 MUL_2009 Probable phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 2 Mycobacterium ulcerans (strain Agy99)
Q5KWV8 4.29e-05 47 28 3 108 3 GK2543 Uncharacterized methyltransferase GK2543 Geobacillus kaustophilus (strain HTA426)
C3K6J1 4.84e-05 47 25 8 190 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain SBW25)
Q1IDA6 5.17e-05 46 25 8 190 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas entomophila (strain L48)
Q89AK7 5.24e-05 47 26 6 164 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9C6B9 6.71e-05 47 26 3 125 1 NMT3 Phosphoethanolamine N-methyltransferase 3 Arabidopsis thaliana
Q56308 6.77e-05 47 28 3 133 1 pcm Protein-L-isoaspartate O-methyltransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q55214 7.4e-05 46 28 3 140 1 dauC Aklanonic acid methyltransferase DauC Streptomyces sp. (strain C5)
Q97A64 8.2e-05 45 29 2 109 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
B1J5G4 9.85e-05 45 25 8 189 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain W619)
A6V2Q4 0.000104 45 23 6 187 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain PA7)
Q97WC7 0.000108 45 23 2 109 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
H2E7U0 0.000115 46 23 4 162 2 SMT-3 Sterol methyltransferase-like 3 Botryococcus braunii
Q91WU5 0.000136 46 28 3 109 1 As3mt Arsenite methyltransferase Mus musculus
Q50LG3 0.00015 46 26 5 149 3 AFT9-1 Highly reducing polyketide synthase AFT9-1 Alternaria alternata
Q119M3 0.000161 45 22 5 149 3 cmoA Carboxy-S-adenosyl-L-methionine synthase Trichodesmium erythraeum (strain IMS101)
Q8VYX1 0.000162 46 28 4 111 1 PEAMT1 Phosphoethanolamine N-methyltransferase 1 Triticum aestivum
Q8VYX1 0.001 43 26 3 133 1 PEAMT1 Phosphoethanolamine N-methyltransferase 1 Triticum aestivum
Q3BSF8 0.000168 45 27 4 133 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A0A8X8M4W6 0.000177 45 22 3 139 2 TMT3 Gamma-tocopherol methyltransferase, chloroplastic Catharanthus roseus
P08442 0.000182 45 22 5 166 4 syc1184_c Uncharacterized protein syc1184_c Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q9KJ20 0.000232 45 25 2 116 1 None Glycine/sarcosine/dimethylglycine N-methyltransferase Actinopolyspora halophila

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18410
Feature type CDS
Gene ubiE
Product bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
Location 15796 - 16551 (strand: -1)
Length 756 (nucleotides) / 251 (amino acids)

Contig

Accession term accessions NZ_VXKB01000009 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 74461 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_216
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF01209 ubiE/COQ5 methyltransferase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2226 Coenzyme transport and metabolism (H) H Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG

Kegg Ortholog Annotation(s)

Protein Sequence

MEEQSRDKIDFGFRTVNKSEKEGMVANVFHSVAAKYDLMNDLMSFGIHRIWKRFTIDASGVRRGQRVLDLAGGTGDFTAKFSRMVGETGQVVLADINDSMLKMGREKLRNNGIIGNVNYVQANAEELPFPDDYFNCIIISFGLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPVIEPLSKVYDAYSFHILPRIGQAVVNDAESYRYLAESIRMHPDQGTLKGMMENAGFEQVSYTNMTGGIVALHKGFKF

Flanking regions ( +/- flanking 50bp)

CTTTTGCGATTATTAAACCGTGTGCACAGGCAAAACAGGCAATATAAAGAATGGAAGAGCAATCCCGGGATAAAATCGATTTTGGTTTTCGCACTGTTAACAAGAGCGAAAAAGAAGGTATGGTGGCAAACGTCTTTCATTCTGTTGCTGCAAAATATGACCTGATGAATGACCTGATGTCTTTCGGCATCCATCGTATCTGGAAGCGTTTTACCATAGATGCCAGTGGTGTGCGCCGTGGTCAGCGGGTGCTTGATCTGGCCGGGGGAACCGGTGATTTTACCGCAAAATTCTCCCGTATGGTCGGTGAAACCGGACAGGTTGTTCTCGCGGATATCAATGATTCCATGCTGAAAATGGGCCGCGAAAAACTGCGTAATAACGGGATTATCGGTAACGTCAATTATGTTCAGGCCAATGCAGAAGAACTGCCGTTCCCGGATGATTACTTCAACTGCATTATCATCTCGTTCGGGCTGCGCAATGTCACGGATAAAGATAAAGCACTGCGTTCTATGTTCCGCGTATTAAAACCGGGCGGGCGCCTGCTGGTGCTGGAATTTTCCAAACCGGTTATTGAGCCGCTGAGCAAAGTATATGACGCCTACTCATTCCATATTCTGCCGCGCATCGGACAGGCGGTTGTAAATGATGCCGAAAGCTATCGTTATCTGGCCGAATCTATCCGCATGCACCCCGATCAGGGCACGCTGAAAGGGATGATGGAAAATGCCGGTTTTGAACAGGTGTCCTATACCAACATGACCGGCGGTATTGTCGCACTGCATAAAGGGTTCAAATTCTGATATGACTGATACGTTTGCTGAAAACGCACCGTCTTCCGTCAGTCCGCACG