Homologs in group_216

Help

8 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16940 FBDBKF_16940 26.1 Morganella morganii S1 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
EHELCC_16650 EHELCC_16650 26.1 Morganella morganii S2 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
NLDBIP_16860 NLDBIP_16860 26.1 Morganella morganii S4 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
LHKJJB_16610 LHKJJB_16610 26.1 Morganella morganii S3 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
HKOGLL_17575 HKOGLL_17575 26.1 Morganella morganii S5 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
F4V73_RS18410 F4V73_RS18410 26.1 Morganella psychrotolerans ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
PMI_RS14575 PMI_RS14575 20.5 Proteus mirabilis HI4320 - class I SAM-dependent methyltransferase
PMI_RS17575 PMI_RS17575 25.5 Proteus mirabilis HI4320 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE

Distribution of the homologs in the orthogroup group_216

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_216

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P54458 1.57e-11 65 26 5 222 3 yqeM Putative methyltransferase YqeM Bacillus subtilis (strain 168)
C5D4V7 1.08e-05 48 25 8 226 3 GWCH70_2453 Putative methyltransferase GWCH70_2453 Geobacillus sp. (strain WCH70)
A7GT53 2.2e-05 47 31 5 116 3 Bcer98_3087 Uncharacterized methyltransferase Bcer98_3087 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q7U4Z8 0.000243 45 23 6 195 1 bsmA Glycine/sarcosine N-methyltransferase Parasynechococcus marenigrum (strain WH8102)
Q634G9 0.000354 44 30 5 116 3 BCE33L4119 Uncharacterized methyltransferase BCE33L4119 Bacillus cereus (strain ZK / E33L)
Q6HDF0 0.000354 44 30 5 116 1 BT9727_4108 Uncharacterized methyltransferase BT9727_4108 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q29513 0.000475 44 25 3 135 1 GNMT Glycine N-methyltransferase Oryctolagus cuniculus
A9VHZ6 0.000859 43 29 5 116 3 BcerKBAB4_4222 Uncharacterized methyltransferase BcerKBAB4_4222 Bacillus mycoides (strain KBAB4)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03975
Feature type CDS
Gene -
Product class I SAM-dependent methyltransferase
Location 895392 - 896147 (strand: 1)
Length 756 (nucleotides) / 251 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_216
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF13649 Methyltransferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2226 Coenzyme transport and metabolism (H) H Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG

Protein Sequence

MQSYHSLSAQVYQLDKPIGCSFGDVEYYQQRLKDVKGKILEPAVGTGRILIPLLQSGFNIEGFDLSEEMLEFCKKNLIEHGFTTNYVTQNNLVTFEVNTPVEAIIIPTGTFLLLNTQQQAIQALKQCYQALEFGGRLLVDISLAHHFVKGECTSRQFNTPEGDLITLQIINAEIDYINQLTTSHHRYDKWRDGKIIESEWEVFSLKWFGVSEFEQILRLIGFKQITISADYQYLQTPSNTTEIMTFEAYKK

Flanking regions ( +/- flanking 50bp)

TTTTTCTTTTTAATAAGATACATAAAAATTGGTACAGACTAAGGGATATTATGCAGAGTTATCACTCTCTATCGGCTCAAGTTTATCAATTGGATAAACCGATAGGATGCAGTTTCGGCGATGTTGAATACTATCAACAGCGATTAAAAGATGTTAAAGGTAAAATTTTAGAGCCGGCAGTAGGAACAGGACGTATCCTTATTCCTTTATTGCAATCAGGTTTTAATATTGAGGGATTTGATCTTTCCGAAGAGATGCTTGAATTTTGTAAGAAAAATCTAATCGAGCATGGATTTACAACCAACTACGTAACTCAAAATAATTTAGTCACTTTTGAAGTTAATACCCCTGTCGAGGCTATTATTATTCCTACAGGGACATTCCTCTTATTAAATACGCAACAGCAGGCGATCCAAGCCTTAAAACAGTGTTATCAAGCGCTTGAGTTTGGTGGGCGCTTATTGGTTGATATTAGTCTTGCCCATCATTTTGTTAAAGGTGAATGTACTAGTCGCCAATTTAATACACCAGAAGGCGATCTAATTACCTTACAGATAATTAATGCTGAAATTGATTATATAAATCAGTTAACTACTTCACACCATCGTTATGATAAATGGCGAGATGGCAAGATCATTGAAAGTGAATGGGAAGTTTTCAGCTTAAAATGGTTTGGTGTGTCTGAATTTGAACAAATACTACGCTTGATTGGTTTTAAACAGATCACAATATCAGCCGATTACCAGTATCTGCAAACCCCCAGTAATACGACAGAAATTATGACTTTTGAAGCGTATAAAAAATAGCATTAAATAATAAGAGGCTGTATTTAAAGCTAATTTTTTATAGCCTCATT