Homologs in group_4104

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4104

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4104

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B3PI89 1.88e-13 73 43 3 95 3 bioC Biotin biosynthesis bifunctional protein BioHC Cellvibrio japonicus (strain Ueda107)
A9WRT1 2.26e-13 70 34 3 132 3 menG Demethylmenaquinone methyltransferase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
D2T333 4.85e-13 70 36 3 119 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96)
A1R990 1.01e-11 66 33 3 132 3 menG Demethylmenaquinone methyltransferase Paenarthrobacter aurescens (strain TC1)
A1SE26 5.55e-11 63 32 4 141 3 menG Demethylmenaquinone methyltransferase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q820B5 5.57e-11 64 30 2 123 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBI0 5.57e-11 64 30 2 123 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J1W2 5.57e-11 64 30 2 123 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain CbuG_Q212)
B6J5Y2 6.2e-11 63 30 2 123 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain CbuK_Q154)
A9KGL7 6.91e-11 63 30 2 123 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain Dugway 5J108-111)
P46326 9.15e-11 63 33 2 103 3 yxbB Uncharacterized protein YxbB Bacillus subtilis (strain 168)
Q5YPB0 9.98e-11 63 31 3 142 3 menG Demethylmenaquinone methyltransferase Nocardia farcinica (strain IFM 10152)
A0QRH1 1.16e-10 63 33 5 145 3 menG Demethylmenaquinone methyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
C5C0T0 1.34e-10 63 30 3 142 3 menG Demethylmenaquinone methyltransferase Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q8TJK1 1.7e-10 63 36 5 111 1 arsM Arsenite methyltransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q16DL1 2.17e-10 62 33 3 117 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A0PLV5 3.04e-10 62 33 3 142 3 menG Demethylmenaquinone methyltransferase Mycobacterium ulcerans (strain Agy99)
P64842 3.49e-10 62 29 0 108 3 BQ2027_MB1440C Uncharacterized protein Mb1440c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WLY7 3.49e-10 62 29 0 108 1 Rv1405c Uncharacterized protein Rv1405c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WLY6 3.49e-10 62 29 0 108 3 MT1449 Uncharacterized protein MT1449 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
B2HRQ2 3.65e-10 62 33 3 142 3 menG Demethylmenaquinone methyltransferase Mycobacterium marinum (strain ATCC BAA-535 / M)
Q55423 4.3e-10 61 33 6 148 3 sll0829 Uncharacterized methyltransferase sll0829 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9XAP8 4.4e-10 61 30 3 146 3 menG Demethylmenaquinone methyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q58630 4.91e-10 62 37 4 117 4 MJ1233 Uncharacterized protein MJ1233 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q72HI4 5.75e-10 61 32 1 115 3 menG Demethylmenaquinone methyltransferase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
E3G327 6.22e-10 61 32 1 116 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Enterobacter lignolyticus (strain SCF1)
Q81ZX2 7.23e-10 60 30 3 142 3 menG Demethylmenaquinone methyltransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q67LE6 9.6e-10 60 32 8 164 3 menG Demethylmenaquinone methyltransferase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q6ANL3 1.28e-09 60 30 4 146 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A4T3V1 1.49e-09 60 33 1 95 3 Mflv_0427 Uncharacterized methyltransferase Mflv_0427 Mycolicibacterium gilvum (strain PYR-GCK)
Q9RRT0 1.53e-09 60 34 1 116 3 menG Demethylmenaquinone methyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
B9LZA9 1.63e-09 60 30 2 119 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A3PUJ1 1.87e-09 59 30 4 149 3 menG Demethylmenaquinone methyltransferase Mycobacterium sp. (strain JLS)
P9WFR3 1.93e-09 59 32 3 142 1 menG Demethylmenaquinone methyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFR2 1.93e-09 59 32 3 142 3 menG Demethylmenaquinone methyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5TZT8 1.93e-09 59 32 3 142 3 menG Demethylmenaquinone methyltransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AKN8 1.93e-09 59 32 3 142 3 menG Demethylmenaquinone methyltransferase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KG35 1.93e-09 59 32 3 142 3 menG Demethylmenaquinone methyltransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A639 1.93e-09 59 32 3 142 3 menG Demethylmenaquinone methyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q2YY85 2.24e-09 59 31 5 157 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
P36571 2.98e-09 59 33 4 112 1 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Serratia marcescens
Q88SI6 3.36e-09 59 29 3 155 3 menG Demethylmenaquinone methyltransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q1GC56 3.42e-09 59 31 3 116 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Ruegeria sp. (strain TM1040)
Q1BE01 3.72e-09 58 30 4 149 3 menG Demethylmenaquinone methyltransferase Mycobacterium sp. (strain MCS)
A1UAY5 3.72e-09 58 30 4 149 3 menG Demethylmenaquinone methyltransferase Mycobacterium sp. (strain KMS)
Q6GGU0 3.85e-09 58 31 5 157 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain MRSA252)
P67064 4.85e-09 58 31 7 163 3 menG Demethylmenaquinone methyltransferase Tropheryma whipplei (strain Twist)
P67065 4.85e-09 58 31 7 163 3 menG Demethylmenaquinone methyltransferase Tropheryma whipplei (strain TW08/27)
Q4L6H3 4.95e-09 58 33 5 127 3 menG Demethylmenaquinone methyltransferase Staphylococcus haemolyticus (strain JCSC1435)
D8MPW4 5.02e-09 58 33 4 132 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Erwinia billingiae (strain Eb661)
Q2SBD7 7.86e-09 58 33 3 134 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Hahella chejuensis (strain KCTC 2396)
Q24W96 8.48e-09 58 29 5 142 3 menG Demethylmenaquinone methyltransferase Desulfitobacterium hafniense (strain Y51)
A4WVR7 8.84e-09 58 32 2 116 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q1RJC7 8.98e-09 57 30 2 118 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia bellii (strain RML369-C)
A8GX11 8.98e-09 57 30 2 118 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia bellii (strain OSU 85-389)
P12999 9e-09 58 34 4 108 1 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Escherichia coli (strain K12)
Q47LE2 1.16e-08 57 31 3 144 3 menG Demethylmenaquinone methyltransferase Thermobifida fusca (strain YX)
Q21FY5 1.26e-08 58 32 4 133 3 bioC Biotin biosynthesis bifunctional protein BioHC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B9KQJ8 1.27e-08 57 31 2 116 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3IY65 1.27e-08 57 31 2 116 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PFL1 1.27e-08 57 31 2 116 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
O52025 1.53e-08 58 31 4 125 2 arsM Arsenite methyltransferase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
D5DIV9 1.67e-08 57 32 5 101 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Priestia megaterium (strain DSM 319 / IMG 1521)
O34954 1.99e-08 57 35 1 100 3 yodH Uncharacterized methyltransferase YodH Bacillus subtilis (strain 168)
Q89AK7 2.56e-08 56 33 4 133 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A0QMC8 2.79e-08 56 30 2 109 3 MAV_4945 Uncharacterized methyltransferase MAV_4945 Mycobacterium avium (strain 104)
P70976 3e-08 56 28 4 174 3 ybaJ Uncharacterized methyltransferase YbaJ Bacillus subtilis (strain 168)
P67063 3.09e-08 56 31 5 157 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain MW2)
A8Z450 3.09e-08 56 31 5 157 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G992 3.09e-08 56 31 5 157 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain MSSA476)
P67062 3.09e-08 56 31 5 157 1 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain N315)
P67061 3.09e-08 56 31 5 157 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QH20 3.09e-08 56 31 5 157 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain Newman)
Q5HFV2 3.09e-08 56 31 5 157 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain COL)
A5ISZ9 3.09e-08 56 31 5 157 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain JH9)
A6U1T9 3.09e-08 56 31 5 157 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain JH1)
A7X2H6 3.09e-08 56 31 5 157 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
C0R2Q3 3.78e-08 56 32 3 116 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Wolbachia sp. subsp. Drosophila simulans (strain wRi)
H2E7U0 4.09e-08 57 27 8 210 2 SMT-3 Sterol methyltransferase-like 3 Botryococcus braunii
B0RCZ0 4.1e-08 56 34 1 114 3 menG Demethylmenaquinone methyltransferase Clavibacter sepedonicus
Q6D3C1 4.28e-08 56 30 3 124 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7CH67 4.47e-08 56 32 4 131 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Yersinia pestis
Q6MHQ3 4.5e-08 55 30 1 114 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A6W0X8 4.74e-08 56 35 5 112 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Marinomonas sp. (strain MWYL1)
Q8KF69 5.02e-08 55 35 3 101 3 menG Demethylmenaquinone methyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q73TQ5 5.26e-08 55 26 5 161 3 MAP_3663c Uncharacterized methyltransferase MAP_3663c Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q8CSH9 5.32e-08 55 32 4 137 3 menG Demethylmenaquinone methyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HP74 5.32e-08 55 32 4 137 3 menG Demethylmenaquinone methyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B8DBZ5 5.82e-08 55 30 4 125 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4a (strain HCC23)
P67055 6.04e-08 55 32 4 125 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71Y84 6.04e-08 55 32 4 125 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4b (strain F2365)
C1KWN1 6.04e-08 55 32 4 125 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4b (strain CLIP80459)
P67056 6.04e-08 55 32 4 125 3 menG Demethylmenaquinone methyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B3QLI9 6.14e-08 55 35 3 101 3 menG Demethylmenaquinone methyltransferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A0AK43 6.28e-08 55 32 4 125 3 menG Demethylmenaquinone methyltransferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q73SL8 6.6e-08 55 31 4 150 3 menG Demethylmenaquinone methyltransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q3IYM5 7.23e-08 55 32 0 100 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PNM3 7.37e-08 55 32 0 100 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B9KPP7 7.65e-08 55 32 0 100 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A1T1P0 8.06e-08 55 32 1 95 3 Mvan_0241 Uncharacterized methyltransferase Mvan_0241 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q748B2 8.54e-08 55 36 3 97 3 prmC Release factor glutamine methyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q96WX4 1.06e-07 55 30 3 114 1 erg6 Sterol 24-C-methyltransferase Pneumocystis carinii (strain B80)
P20187 1.1e-07 55 25 3 128 3 None Uncharacterized 37.1 kDa protein in transposon TN4556 Streptomyces fradiae
O31474 1.12e-07 55 31 1 101 1 ycgJ Uncharacterized methyltransferase YcgJ Bacillus subtilis (strain 168)
Q73HZ4 1.22e-07 54 32 3 116 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Wolbachia pipientis wMel
A1BAN1 1.28e-07 54 29 5 152 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Paracoccus denitrificans (strain Pd 1222)
Q8A005 1.37e-07 54 27 3 143 3 menG Demethylmenaquinone methyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A4WW91 1.43e-07 54 30 0 100 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
C5BMZ8 1.49e-07 55 36 5 108 3 bioC Biotin biosynthesis bifunctional protein BioHC Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q9F8T9 1.68e-07 54 30 7 152 1 couO C-methyltransferase CouO Streptomyces rishiriensis
Q5GZB5 1.77e-07 54 33 2 99 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SHS9 1.77e-07 54 33 2 99 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P2C4 1.77e-07 54 33 2 99 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q64XV8 1.82e-07 54 28 2 118 3 menG Demethylmenaquinone methyltransferase Bacteroides fragilis (strain YCH46)
Q5LH04 1.82e-07 54 28 2 118 3 menG Demethylmenaquinone methyltransferase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A4F7P5 1.99e-07 54 31 5 139 1 eryG Erythromycin 3''-O-methyltransferase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q0AA73 2.05e-07 53 31 1 101 3 ubiG Ubiquinone biosynthesis O-methyltransferase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A6VDI6 2.5e-07 53 37 4 113 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain PA7)
Q7NZ91 2.66e-07 53 33 2 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A5TYU9 2.68e-07 53 27 2 142 3 MRA_0232 Uncharacterized methyltransferase MRA_0232 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P9WJZ9 2.68e-07 53 27 2 142 1 Rv0224c Uncharacterized methyltransferase Rv0224c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJZ8 2.68e-07 53 27 2 142 3 MT0234 Uncharacterized methyltransferase MT0234 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8NT39 2.71e-07 53 31 5 151 3 menG Demethylmenaquinone methyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q6G577 2.87e-07 53 28 6 174 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A4QBE5 2.9e-07 53 31 5 151 3 menG Demethylmenaquinone methyltransferase Corynebacterium glutamicum (strain R)
Q5LWM6 3.35e-07 53 32 1 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A7NF26 3.41e-07 53 30 4 141 3 menG Demethylmenaquinone methyltransferase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
C6E4U6 3.59e-07 53 27 4 165 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Geobacter sp. (strain M21)
A8GPB1 3.94e-07 53 31 1 98 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia akari (strain Hartford)
O66128 3.99e-07 53 28 7 160 3 menG Demethylmenaquinone methyltransferase Micrococcus luteus
A1T3S1 4.09e-07 53 30 3 142 3 menG Demethylmenaquinone methyltransferase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
B2HMZ9 4.09e-07 53 32 2 98 3 MMAR_0473 Uncharacterized methyltransferase MMAR_0473 Mycobacterium marinum (strain ATCC BAA-535 / M)
Q1I3T0 4.19e-07 53 31 7 157 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas entomophila (strain L48)
B0KM36 4.23e-07 53 31 7 157 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida (strain GB-1)
O06898 4.41e-07 53 29 1 117 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pseudescherichia vulneris
Q0AME1 4.5e-07 53 27 2 155 3 ubiG Ubiquinone biosynthesis O-methyltransferase Maricaulis maris (strain MCS10)
B1J2S8 4.52e-07 53 31 7 157 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida (strain W619)
A1U9D7 4.7e-07 53 31 1 93 3 Mkms_0228 Uncharacterized methyltransferase Mkms_0228 Mycobacterium sp. (strain KMS)
Q1BFJ5 4.7e-07 53 31 1 93 3 Mmcs_0218 Uncharacterized methyltransferase Mmcs_0218 Mycobacterium sp. (strain MCS)
Q9Z439 4.83e-07 53 31 7 157 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida
B1MHC3 4.9e-07 52 31 3 140 3 menG Demethylmenaquinone methyltransferase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q8ZQQ6 4.94e-07 53 29 1 121 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P59911 5.31e-07 53 32 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A3PSZ4 5.62e-07 52 31 1 93 3 Mjls_0208 Uncharacterized methyltransferase Mjls_0208 Mycobacterium sp. (strain JLS)
I1RGC4 5.63e-07 53 33 5 131 2 FG02783.1 Sterol 24-C-methyltransferase ERG6A Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q9HUC0 6.17e-07 52 36 4 113 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02EV4 6.17e-07 52 36 4 113 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3F6 6.17e-07 52 36 4 113 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain LESB58)
Q49XS5 6.23e-07 52 28 4 126 3 menG Demethylmenaquinone methyltransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A8LNK7 6.27e-07 52 27 2 116 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q8P8H2 6.54e-07 52 32 2 99 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RS27 6.54e-07 52 32 2 99 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q4UVL4 6.54e-07 52 32 2 99 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain 8004)
P0CT10 6.56e-07 53 30 2 123 3 ERG6 Sterol 24-C-methyltransferase Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
L7IP31 6.56e-07 53 30 2 123 2 ERG6 Sterol 24-C-methyltransferase Pyricularia oryzae (strain Y34)
A4T183 6.96e-07 52 30 3 142 3 menG Demethylmenaquinone methyltransferase Mycolicibacterium gilvum (strain PYR-GCK)
Q885T9 7.19e-07 52 32 2 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A0A0E0SMA3 7.34e-07 53 35 2 98 2 ERG6B Sterol 24-C-methyltransferase ERG6B Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q94JS4 7.65e-07 53 33 4 115 2 SMT3 24-methylenesterol C-methyltransferase 3 Arabidopsis thaliana
Q68WB5 7.71e-07 52 24 5 190 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
O13871 7.74e-07 52 27 3 122 3 SPAC1B3.06c Uncharacterized methyltransferase C1B3.06c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A7HTX8 8.24e-07 52 26 0 101 3 ubiG Ubiquinone biosynthesis O-methyltransferase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
C3LPS5 8.46e-07 52 25 5 155 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain M66-2)
Q9KVQ6 8.46e-07 52 25 5 155 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4E5 8.46e-07 52 25 5 155 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q4ZQ90 9.93e-07 52 30 2 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas syringae pv. syringae (strain B728a)
Q48FM4 9.93e-07 52 30 2 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
C4LL93 1.01e-06 52 28 3 140 3 menG Demethylmenaquinone methyltransferase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
B1MK43 1.02e-06 52 29 2 106 3 MAB_4481 Uncharacterized methyltransferase MAB_4481 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q5X0X6 1.03e-06 52 34 4 113 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Legionella pneumophila (strain Paris)
Q87UZ2 1.04e-06 52 31 7 157 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A9ILA7 1.09e-06 52 31 3 119 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q8KCD5 1.09e-06 52 34 4 122 3 prmC Release factor glutamine methyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8STN5 1.12e-06 51 31 5 129 3 ECU09_1500 Putative methyltransferase ECU09_1500 Encephalitozoon cuniculi (strain GB-M1)
Q16D32 1.16e-06 52 32 0 95 3 ubiG Ubiquinone biosynthesis O-methyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q4ZZG3 1.18e-06 52 31 7 157 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas syringae pv. syringae (strain B728a)
Q48PJ4 1.18e-06 52 31 7 157 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B0SW81 1.19e-06 52 31 1 101 3 ubiG Ubiquinone biosynthesis O-methyltransferase Caulobacter sp. (strain K31)
Q6ZIX2 1.19e-06 52 28 3 132 2 Smt1-1 Cycloartenol-C-24-methyltransferase 1 Oryza sativa subsp. japonica
A0A1D6NER6 1.22e-06 52 25 3 140 2 PEAMT1 Phosphoethanolamine N-methyltransferase 1 Zea mays
Q9Z5E9 1.22e-06 50 31 7 154 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (Fragment) Pseudomonas oleovorans
A5II90 1.22e-06 52 33 3 112 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Legionella pneumophila (strain Corby)
C3PKL1 1.29e-06 51 30 3 150 3 menG Demethylmenaquinone methyltransferase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q5WSQ8 1.29e-06 51 34 4 113 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Legionella pneumophila (strain Lens)
Q8FSB3 1.39e-06 51 35 2 103 3 menG Demethylmenaquinone methyltransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q4UME7 1.4e-06 51 28 1 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q3BSF8 1.4e-06 51 32 2 99 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q6N3Y0 1.41e-06 52 30 6 139 1 arsM Arsenite methyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q3KJC5 1.43e-06 51 31 7 157 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas fluorescens (strain Pf0-1)
O69492 1.47e-06 51 28 2 136 3 ML2584 Uncharacterized methyltransferase ML2584 Mycobacterium leprae (strain TN)
B8ZTF7 1.47e-06 51 28 2 136 3 MLBr02584 Uncharacterized methyltransferase MLBr02584 Mycobacterium leprae (strain Br4923)
B9DNV5 1.55e-06 51 28 2 125 3 menG Demethylmenaquinone methyltransferase Staphylococcus carnosus (strain TM300)
Q8PK00 1.56e-06 51 32 2 99 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas axonopodis pv. citri (strain 306)
Q6MCB5 1.56e-06 51 32 3 120 3 menG Demethylmenaquinone methyltransferase Protochlamydia amoebophila (strain UWE25)
B0KTX4 1.56e-06 51 30 4 113 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain GB-1)
P54458 1.57e-06 51 35 3 109 3 yqeM Putative methyltransferase YqeM Bacillus subtilis (strain 168)
Q88M10 1.67e-06 51 30 4 113 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W7G3 1.67e-06 51 30 4 113 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A1KF44 1.69e-06 51 26 2 142 3 BCG_0261c Uncharacterized methyltransferase BCG_0261c Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U2J0 1.69e-06 51 26 2 142 1 BQ2027_MB0229C Uncharacterized methyltransferase Mb0229c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9L9F3 1.74e-06 51 27 9 180 1 novO 8-demethylnovobiocic acid C(8)-methyltransferase Streptomyces niveus
Q6G5K3 1.78e-06 51 29 1 124 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q7MQ33 1.81e-06 51 26 7 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio vulnificus (strain YJ016)
Q8DDP9 1.81e-06 51 26 7 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio vulnificus (strain CMCP6)
B8EI29 1.86e-06 51 27 2 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B8H209 1.98e-06 51 33 1 98 3 ubiG Ubiquinone biosynthesis O-methyltransferase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A9X1 1.98e-06 51 33 1 98 3 ubiG Ubiquinone biosynthesis O-methyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q7MVR7 2.14e-06 51 30 2 117 3 menG Demethylmenaquinone methyltransferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
C3K8U4 2.17e-06 51 30 7 157 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas fluorescens (strain SBW25)
A8EY40 2.2e-06 50 28 1 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia canadensis (strain McKiel)
A4YKT6 2.25e-06 51 28 2 106 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bradyrhizobium sp. (strain ORS 278)
B1VEN4 2.27e-06 50 37 2 96 3 menG Demethylmenaquinone methyltransferase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
A3QIE1 2.33e-06 50 28 3 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B2RJE9 2.37e-06 50 30 2 117 3 menG Demethylmenaquinone methyltransferase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q5ZRH9 2.38e-06 50 34 4 113 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A6UYW3 2.41e-06 51 31 5 122 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pseudomonas aeruginosa (strain PA7)
Q88D17 2.47e-06 50 30 7 157 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WA45 2.47e-06 50 30 7 157 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A0PMY7 2.48e-06 50 31 2 98 3 MUL_1123 Uncharacterized methyltransferase MUL_1123 Mycobacterium ulcerans (strain Agy99)
B1J5G4 2.48e-06 50 29 4 113 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain W619)
C1DCV3 2.61e-06 50 29 4 144 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Laribacter hongkongensis (strain HLHK9)
Q609U9 2.66e-06 50 35 5 102 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
O14321 2.66e-06 51 27 5 174 2 erg6 Sterol 24-C-methyltransferase erg6 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q92H07 2.91e-06 50 30 1 98 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A8LQ43 2.91e-06 50 31 0 98 3 ubiG Ubiquinone biosynthesis O-methyltransferase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A8G0S7 2.91e-06 50 28 3 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sediminis (strain HAW-EB3)
B4EWC9 2.94e-06 50 31 3 103 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Proteus mirabilis (strain HI4320)
P36566 3.06e-06 50 35 3 113 1 cmoM tRNA 5-carboxymethoxyuridine methyltransferase Escherichia coli (strain K12)
Q8XDG3 3.06e-06 50 35 3 113 1 cmoM tRNA 5-carboxymethoxyuridine methyltransferase Escherichia coli O157:H7
Q9CKD6 3.09e-06 50 29 6 141 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pasteurella multocida (strain Pm70)
A8H966 3.23e-06 50 27 3 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
C1DHS2 3.24e-06 50 31 5 137 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A7MTX1 3.62e-06 50 27 3 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio campbellii (strain ATCC BAA-1116)
A4XPM7 3.9e-06 50 34 4 113 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas mendocina (strain ymp)
Q87TH4 3.93e-06 50 28 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
H2E7T8 3.95e-06 50 29 3 114 2 SMT-1 Sterol methyltransferase-like 1 Botryococcus braunii
Q3SVP3 4.09e-06 50 28 2 106 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B0TJ16 4.12e-06 50 27 3 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella halifaxensis (strain HAW-EB4)
Q7VKW2 4.37e-06 50 32 1 101 3 ubiG Ubiquinone biosynthesis O-methyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q3ED65 4.57e-06 50 33 5 139 1 MENG 2-phytyl-1,4-beta-naphthoquinone methyltransferase, chloroplastic Arabidopsis thaliana
Q5ZT34 4.74e-06 50 32 2 99 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q8KZ94 4.99e-06 50 28 4 142 1 rebM Demethylrebeccamycin-D-glucose O-methyltransferase Lentzea aerocolonigenes
O82427 5.01e-06 50 31 2 103 2 Smt2-1 24-methylenesterol C-methyltransferase 2 Oryza sativa subsp. japonica
Q9ZCT9 5.33e-06 50 24 5 180 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia prowazekii (strain Madrid E)
Q3K8T6 5.74e-06 49 30 4 113 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain Pf0-1)
B0UAV0 6.08e-06 49 26 1 123 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylobacterium sp. (strain 4-46)
Q84BQ9 6.09e-06 49 37 3 83 1 prmA Ribosomal protein L11 methyltransferase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q4K8M4 6.36e-06 49 30 4 113 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B0U3W1 6.81e-06 49 27 2 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain M12)
C3K6J1 7.06e-06 49 30 4 113 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain SBW25)
H2E7T9 7.56e-06 50 33 3 107 2 SMT-2 Sterol methyltransferase-like 2 Botryococcus braunii
Q9K075 7.86e-06 49 27 5 150 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q8EDK8 7.94e-06 49 30 6 172 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q5QZ53 8.05e-06 49 26 4 154 3 ubiG Ubiquinone biosynthesis O-methyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q28VP7 8.06e-06 49 30 0 98 3 ubiG Ubiquinone biosynthesis O-methyltransferase Jannaschia sp. (strain CCS1)
B1KR07 8.3e-06 49 27 3 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella woodyi (strain ATCC 51908 / MS32)
A1KT06 8.31e-06 49 27 5 150 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JV83 8.39e-06 49 27 5 150 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q6FRZ7 8.51e-06 49 26 4 134 3 ERG6 Sterol 24-C-methyltransferase Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
B5EFL1 8.78e-06 49 27 4 165 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A8HVC4 8.96e-06 49 26 0 98 3 ubiG Ubiquinone biosynthesis O-methyltransferase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q1GCH8 9.59e-06 49 29 2 117 3 ubiG Ubiquinone biosynthesis O-methyltransferase Ruegeria sp. (strain TM1040)
A4G5P1 9.94e-06 49 30 6 167 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Herminiimonas arsenicoxydans
B8CI06 1.02e-05 49 27 3 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella piezotolerans (strain WP3 / JCM 13877)
Q87BG5 1.04e-05 48 27 2 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I705 1.04e-05 48 27 2 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain M23)
B4RK11 1.04e-05 48 27 5 150 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria gonorrhoeae (strain NCCP11945)
Q5F9R9 1.04e-05 48 27 5 150 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A3MZ07 1.12e-05 48 29 1 101 3 ubiG Ubiquinone biosynthesis O-methyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
P65349 1.14e-05 48 33 3 96 3 BQ2027_MB3374 Uncharacterized methyltransferase Mb3374 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WK01 1.14e-05 48 33 3 96 1 Rv3342 Uncharacterized methyltransferase Rv3342 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WK00 1.14e-05 48 33 3 96 3 MT3445 Uncharacterized methyltransferase MT3445 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
B2IUM7 1.17e-05 48 31 7 154 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q9PAM5 1.17e-05 48 27 2 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain 9a5c)
A1SRS4 1.23e-05 48 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A7Z627 1.3e-05 48 27 4 128 3 menG Demethylmenaquinone methyltransferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q66L51 1.33e-05 49 33 1 81 2 coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Danio rerio
Q8YLP4 1.33e-05 48 33 5 122 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q4W9V1 1.35e-05 49 33 3 104 1 erg6 Sterol 24-C-methyltransferase erg6 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q9CBA8 1.38e-05 48 30 3 142 3 menG Demethylmenaquinone methyltransferase Mycobacterium leprae (strain TN)
O84435 1.45e-05 48 32 4 114 3 menG Demethylmenaquinone methyltransferase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KLS2 1.45e-05 48 32 4 114 3 menG Demethylmenaquinone methyltransferase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q2SN12 1.48e-05 48 31 7 148 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Hahella chejuensis (strain KCTC 2396)
Q1LRG9 1.51e-05 48 24 7 219 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q1IDA6 1.52e-05 48 29 4 113 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas entomophila (strain L48)
B0BC65 1.55e-05 48 32 4 114 3 menG Demethylmenaquinone methyltransferase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B800 1.55e-05 48 32 4 114 3 menG Demethylmenaquinone methyltransferase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
A1U3K1 1.62e-05 48 23 8 205 3 ubiG Ubiquinone biosynthesis O-methyltransferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q2W6W0 1.71e-05 48 29 2 131 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B1W525 1.76e-05 48 28 3 142 3 menG Demethylmenaquinone methyltransferase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
A6H162 1.8e-05 48 40 1 72 3 prmC Release factor glutamine methyltransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q9RMN9 1.82e-05 48 32 4 126 3 mtf2 Fatty-acid O-methyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q53514 1.83e-05 48 28 3 119 3 nodS Nodulation protein S Rhizobium tropici
Q6G1I2 1.83e-05 48 31 2 102 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bartonella quintana (strain Toulouse)
Q1QS47 2.01e-05 48 25 4 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q58DP0 2.02e-05 48 38 2 84 2 BUD23 18S rRNA (guanine-N(7))-methyltransferase Bos taurus
C0Z787 2.05e-05 48 27 3 127 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
P34666 2.12e-05 48 29 2 117 3 coq-5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Caenorhabditis elegans
Q5QYG2 2.13e-05 48 27 7 158 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
P94298 2.32e-05 47 24 3 126 3 menG Demethylmenaquinone methyltransferase Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
Q5HYK3 2.55e-05 48 32 1 86 1 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Homo sapiens
Q74EU2 2.68e-05 47 26 2 119 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q39227 2.69e-05 48 30 4 115 1 SMT2 24-methylenesterol C-methyltransferase 2 Arabidopsis thaliana
P74388 2.7e-05 48 29 6 178 1 sll0418 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8P558 2.84e-05 47 28 7 139 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9ZCP3 2.84e-05 47 30 3 104 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia prowazekii (strain Madrid E)
B5XNZ3 2.85e-05 47 28 3 118 3 ubiG Ubiquinone biosynthesis O-methyltransferase Klebsiella pneumoniae (strain 342)
Q944H0 2.87e-05 48 26 3 143 1 NMT2 Phosphoethanolamine N-methyltransferase 2 Arabidopsis thaliana
Q475X0 2.92e-05 47 24 6 219 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q57060 3e-05 47 33 4 107 4 HI_0095 Uncharacterized protein HI_0095 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A9IQF4 3.02e-05 47 29 0 97 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q8VYX1 3.08e-05 48 25 3 140 1 PEAMT1 Phosphoethanolamine N-methyltransferase 1 Triticum aestivum
P26236 3.16e-05 47 26 4 123 1 bchM Magnesium-protoporphyrin O-methyltransferase Rhodobacter capsulatus
A5UVB2 3.32e-05 47 26 3 140 3 menG Demethylmenaquinone methyltransferase Roseiflexus sp. (strain RS-1)
A6VTA1 3.45e-05 47 26 5 151 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Marinomonas sp. (strain MWYL1)
Q5RBK6 3.48e-05 47 32 1 86 2 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Pongo abelii
Q749W5 3.49e-05 47 31 2 116 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A0A1V6NYI6 3.59e-05 48 34 3 105 3 verA Highly reducing polyketide synthase verA Penicillium polonicum
Q12S23 3.68e-05 47 27 3 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q9CXI0 3.74e-05 47 33 1 86 1 Coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Mus musculus
A1UUE1 3.75e-05 47 30 3 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B0U6V1 3.75e-05 47 28 8 166 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xylella fastidiosa (strain M12)
C6DBN5 3.95e-05 47 29 3 118 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q4V7R3 4.03e-05 47 31 1 86 2 coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Xenopus laevis
Q87DI1 4.08e-05 47 28 8 166 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2IA21 4.08e-05 47 28 8 166 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xylella fastidiosa (strain M23)
Q89XU2 4.31e-05 47 28 2 106 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8EXJ3 4.34e-05 47 31 4 123 3 menG Demethylmenaquinone methyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q75FL1 4.34e-05 47 31 4 123 3 menG Demethylmenaquinone methyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q2NYW4 4.39e-05 47 28 7 139 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q9HZ63 4.47e-05 47 29 4 113 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A9M0C4 4.51e-05 47 29 6 157 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup C (strain 053442)
B7V9J5 4.55e-05 47 29 4 113 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain LESB58)
Q4G064 4.57e-05 47 34 1 85 2 Coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Rattus norvegicus
B3H0C8 4.7e-05 47 28 1 101 3 ubiG Ubiquinone biosynthesis O-methyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q9P3R1 4.91e-05 47 32 2 100 3 erg-4 Sterol 24-C-methyltransferase erg-4 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q02PX7 4.99e-05 47 29 4 113 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q65I24 5.09e-05 47 29 5 131 3 menG Demethylmenaquinone methyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A0PQ29 5.18e-05 47 33 2 96 3 MUL_2009 Probable phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 2 Mycobacterium ulcerans (strain Agy99)
B2VG41 5.18e-05 47 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q9JXI7 5.24e-05 47 29 6 157 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q21H69 5.32e-05 47 34 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A7MQL7 5.48e-05 47 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cronobacter sakazakii (strain ATCC BAA-894)
Q2KUG1 5.73e-05 47 26 3 148 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bordetella avium (strain 197N)
Q98G87 5.73e-05 47 27 0 99 3 ubiG Ubiquinone biosynthesis O-methyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A8G8B8 5.74e-05 47 29 5 119 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Serratia proteamaculans (strain 568)
C1DRQ3 5.8e-05 46 30 2 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q9JWE6 5.97e-05 46 31 4 115 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
C5D3E5 6.04e-05 46 23 2 125 3 menG Demethylmenaquinone methyltransferase Geobacillus sp. (strain WCH70)
P31113 6.06e-05 46 27 4 128 1 menG Demethylmenaquinone methyltransferase Bacillus subtilis (strain 168)
A6TBT7 6.22e-05 46 27 3 118 3 ubiG Ubiquinone biosynthesis O-methyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q759S7 6.22e-05 47 29 2 102 3 ERG6 Sterol 24-C-methyltransferase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q92SK7 6.46e-05 46 26 5 152 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhizobium meliloti (strain 1021)
A1WVM4 6.62e-05 47 32 4 100 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Halorhodospira halophila (strain DSM 244 / SL1)
Q4UMW4 6.68e-05 46 30 2 104 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A9M3A0 6.82e-05 46 27 5 150 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria meningitidis serogroup C (strain 053442)
Q31JJ8 6.91e-05 47 31 3 111 3 cmoB tRNA U34 carboxymethyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A0PQX0 7.23e-05 46 32 3 103 3 MUL_2377 Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 1 Mycobacterium ulcerans (strain Agy99)
Q9FR44 7.32e-05 47 25 3 140 1 NMT1 Phosphoethanolamine N-methyltransferase 1 Arabidopsis thaliana
B8IUB0 7.37e-05 46 25 1 125 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
P26026 7.53e-05 46 26 3 119 3 nodS Nodulation protein S Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
O49354 7.61e-05 47 29 1 108 1 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Arabidopsis thaliana
Q9K2B6 8.16e-05 46 31 1 111 3 menG Demethylmenaquinone methyltransferase Chlamydia pneumoniae
Q8PPP2 8.25e-05 46 27 7 139 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xanthomonas axonopodis pv. citri (strain 306)
Q3SK91 8.5e-05 46 23 4 180 3 ubiG Ubiquinone biosynthesis O-methyltransferase Thiobacillus denitrificans (strain ATCC 25259)
O67870 8.52e-05 46 38 3 81 3 prmA Ribosomal protein L11 methyltransferase Aquifex aeolicus (strain VF5)
O74421 8.64e-05 46 32 3 102 3 coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B2AH07 8.66e-05 46 26 4 161 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q6D7X5 8.73e-05 46 30 4 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8GXR2 9.41e-05 46 30 2 104 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia bellii (strain OSU 85-389)
Q1RJY5 9.67e-05 46 30 2 104 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia bellii (strain RML369-C)
H2E7T5 9.71e-05 46 28 4 138 1 TMT-1 Squalene methyltransferase 1 Botryococcus braunii
Q8FUZ3 0.000101 46 28 6 150 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella suis biovar 1 (strain 1330)
Q8IDQ9 0.000103 46 27 5 152 1 PMT Phosphoethanolamine N-methyltransferase Plasmodium falciparum (isolate 3D7)
C8YTM5 0.000104 46 27 1 98 1 PEAMT2 Phosphoethanolamine N-methyltransferase Triticum aestivum
W5U2K2 0.000107 46 25 3 137 1 NMT 3-hydroxy-16-methoxy-2,3-dihydrotabersonine N-methyltransferase Catharanthus roseus
A4VGE5 0.000108 46 31 4 113 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Stutzerimonas stutzeri (strain A1501)
A9MCZ2 0.000109 46 28 6 150 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q0WPT7 0.000111 46 31 2 112 1 At2g41040 Uncharacterized methyltransferase At2g41040, chloroplastic Arabidopsis thaliana
A5GA37 0.000112 45 25 3 140 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Geotalea uraniireducens (strain Rf4)
B3PH48 0.000113 45 34 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cellvibrio japonicus (strain Ueda107)
Q83WC4 0.000116 46 29 6 177 1 None Glycine/sarcosine N-methyltransferase Aphanothece halophytica
P55905 0.000116 46 33 1 90 2 None 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Leishmania donovani
B1JS96 0.000121 45 27 3 132 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CZ4 0.000121 45 27 3 132 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNI8 0.000121 45 27 3 132 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis (strain Pestoides F)
Q1CFZ1 0.000121 45 27 3 132 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R284 0.000121 45 27 3 132 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGR6 0.000121 45 27 3 132 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis
B2K9A4 0.000121 45 27 3 132 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C9H5 0.000121 45 27 3 132 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKF4 0.000121 45 27 3 132 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q68W57 0.000123 45 30 4 108 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A8F2G9 0.00013 45 30 2 104 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia massiliae (strain Mtu5)
Q9PD92 0.000132 45 28 8 166 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xylella fastidiosa (strain 9a5c)
A8GT99 0.000138 45 30 2 104 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia rickettsii (strain Sheila Smith)
B0BUT9 0.000138 45 30 2 104 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia rickettsii (strain Iowa)
Q3MD91 0.00014 45 31 4 122 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
L0E172 0.000145 45 28 3 112 3 phqN Methyltransferase phqN Penicillium fellutanum
A1JIF2 0.000146 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C3PLF4 0.000147 45 30 2 104 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia africae (strain ESF-5)
Q9LM02 0.00015 45 30 2 103 1 SMT1 Cycloartenol-C-24-methyltransferase Arabidopsis thaliana
Q11E01 0.000152 45 29 0 100 3 ubiG Ubiquinone biosynthesis O-methyltransferase Chelativorans sp. (strain BNC1)
Q0P5A2 0.000152 45 31 1 86 2 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Bos taurus
Q92GT5 0.000154 45 30 2 104 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9WZL2 0.000154 45 30 3 139 3 menG Demethylmenaquinone methyltransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B1HTA6 0.000163 45 26 2 120 3 menG Demethylmenaquinone methyltransferase Lysinibacillus sphaericus (strain C3-41)
Q15NL3 0.000166 45 30 4 116 3 cmoB tRNA U34 carboxymethyltransferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q6BRB7 0.000169 45 26 3 138 3 ERG6 Sterol 24-C-methyltransferase Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q3YVD2 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella sonnei (strain Ss046)
P0A889 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella flexneri
Q0SZ25 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella flexneri serotype 5b (strain 8401)
Q32A11 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella dysenteriae serotype 1 (strain Sd197)
Q31UF3 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella boydii serotype 4 (strain Sb227)
B2TVI4 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LM21 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain SMS-3-5 / SECEC)
B6I4H5 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain SE11)
B7NFD6 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A887 0.000174 45 30 5 120 1 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain K12)
B1IW72 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A6U0 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O9:H4 (strain HS)
B1XAJ7 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain K12 / DH10B)
C5A009 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain K12 / MC4100 / BW2952)
B7M638 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O8 (strain IAI1)
B7NV33 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YY82 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A888 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O157:H7
B7L996 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain 55989 / EAEC)
B7UNG3 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZU40 0.000174 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O139:H28 (strain E24377A / ETEC)
P0A2K5 0.000176 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2K6 0.000176 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella typhi
B4TNX9 0.000176 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella schwarzengrund (strain CVM19633)
B5BIX9 0.000176 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella paratyphi A (strain AKU_12601)
C0Q3E1 0.000176 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella paratyphi C (strain RKS4594)
A9MY97 0.000176 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKP4 0.000176 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SZ73 0.000176 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella newport (strain SL254)
B4TBR3 0.000176 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella heidelberg (strain SL476)
B5RFM8 0.000176 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QW73 0.000176 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella enteritidis PT4 (strain P125109)
B5FNW6 0.000176 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella dublin (strain CT_02021853)
Q57HN8 0.000176 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella choleraesuis (strain SC-B67)
B5EZU8 0.000176 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella agona (strain SL483)
Q1R477 0.000176 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain UTI89 / UPEC)
Q8FBJ0 0.000176 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAM1 0.000176 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AI22 0.000176 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O1:K1 / APEC
B7N2E1 0.000176 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O81 (strain ED1a)
B7MHC0 0.000176 45 30 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O45:K1 (strain S88 / ExPEC)
A9MIY3 0.000186 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q21JL7 0.000189 45 25 3 116 3 cmoB tRNA U34 carboxymethyltransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
C3MCY6 0.000194 45 25 5 152 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q5WGT4 0.000196 45 26 6 156 3 menG Demethylmenaquinone methyltransferase Shouchella clausii (strain KSM-K16)
C4K2K3 0.000197 45 30 2 104 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia peacockii (strain Rustic)
A8ACY2 0.000204 45 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
H2E7T7 0.000209 45 23 5 171 1 TMT-3 Botryococcene C-methyltransferase Botryococcus braunii
Q6G0I1 0.000211 45 32 0 76 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella quintana (strain Toulouse)
Q9RXR2 0.000216 45 32 3 100 3 prmC Release factor glutamine methyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q8YDE4 0.000221 45 28 6 150 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RMK3 0.000221 45 28 6 150 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella melitensis biotype 2 (strain ATCC 23457)
Q576Q0 0.000221 45 28 6 150 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella abortus biovar 1 (strain 9-941)
Q2YJM4 0.000221 45 28 6 150 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella abortus (strain 2308)
B2SC50 0.000221 45 28 6 150 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella abortus (strain S19)
A8GGX8 0.000225 45 27 3 117 3 ubiG Ubiquinone biosynthesis O-methyltransferase Serratia proteamaculans (strain 568)
Q9C6B9 0.000227 45 27 1 98 1 NMT3 Phosphoethanolamine N-methyltransferase 3 Arabidopsis thaliana
Q0KEH6 0.000227 45 24 4 161 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B4SJ34 0.000236 45 29 6 129 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Stenotrophomonas maltophilia (strain R551-3)
A8EZP4 0.000242 45 30 2 104 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia canadensis (strain McKiel)
B0UUV6 0.000249 45 27 2 122 3 ubiG Ubiquinone biosynthesis O-methyltransferase Histophilus somni (strain 2336)
Q8CWG0 0.000252 44 26 4 128 3 menG Demethylmenaquinone methyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
C5D4V7 0.000254 45 29 4 117 3 GWCH70_2453 Putative methyltransferase GWCH70_2453 Geobacillus sp. (strain WCH70)
B0TSA0 0.00027 45 27 4 125 3 cmoB tRNA U34 carboxymethyltransferase Shewanella halifaxensis (strain HAW-EB4)
A6WYI0 0.000273 45 33 3 100 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q9CD86 0.000279 45 29 2 105 3 ML0130 Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase Mycobacterium leprae (strain TN)
Q0I3Y4 0.000279 44 27 2 122 3 ubiG Ubiquinone biosynthesis O-methyltransferase Histophilus somni (strain 129Pt)
A7MPA9 0.000286 44 27 3 118 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
A6TGL3 0.000292 44 28 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7LU01 0.000298 44 29 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B5XYI1 0.000306 44 28 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Klebsiella pneumoniae (strain 342)
A1AVT4 0.000307 45 31 3 116 3 cmoB tRNA U34 carboxymethyltransferase Ruthia magnifica subsp. Calyptogena magnifica
Q7VRJ1 0.000308 44 29 5 124 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Blochmanniella floridana
Q9KCC4 0.000308 44 25 3 127 3 menG Demethylmenaquinone methyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q13EN8 0.000327 44 23 5 154 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhodopseudomonas palustris (strain BisB5)
Q54XD0 0.000351 44 29 3 110 3 coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Dictyostelium discoideum
B1JP75 0.000352 44 28 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FT0 0.000352 44 28 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TR39 0.000352 44 28 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis (strain Pestoides F)
Q1CNB4 0.000352 44 28 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis bv. Antiqua (strain Nepal516)
A9R431 0.000352 44 28 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis bv. Antiqua (strain Angola)
Q8D1I3 0.000352 44 28 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis
B2K0Y4 0.000352 44 28 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FDE0 0.000352 44 28 5 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B7LM95 0.000355 44 27 3 118 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B3PFU1 0.000372 44 27 4 117 3 cmoB tRNA U34 carboxymethyltransferase Cellvibrio japonicus (strain Ueda107)
Q9CHX0 0.000384 44 31 7 141 3 prmC Release factor glutamine methyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
Q6DAQ7 0.0004 44 26 3 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P64840 0.000427 44 29 2 112 3 BQ2027_MB1438C Uncharacterized protein Mb1438c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WLY9 0.000427 44 29 2 112 3 Rv1403c Uncharacterized protein Rv1403c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WLY8 0.000427 44 29 2 112 3 MT1447 Uncharacterized protein MT1447 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14575
Feature type CDS
Gene -
Product class I SAM-dependent methyltransferase
Location 3231550 - 3232329 (strand: -1)
Length 780 (nucleotides) / 259 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4104
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF08241 Methyltransferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2226 Coenzyme transport and metabolism (H) H Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG

Protein Sequence

MTNKIDNNQLLHDVTRYWNIRAESYSAANQQELLSEKQQKWRQLLLSHVKEGETLKVLDIGTGPGFFAILLALSGHQVTAIDATPGMLLEAKNNASQHNVSINFVCGDVQDLPFGDEQFDLVVSRNVTWNLKSPCEAYQEWFRVLKPGGSLINFDANWYLHLFDDEYWQGFLADRERAAQKQVADHYVNTDTKEMERIARQLPLSQVKRPQWDINTLLDIGFIRYSVDIRIGDHVWDEEEKINYGSTPMFMIHAQKNNR

Flanking regions ( +/- flanking 50bp)

CGTTTAGGGAATTTTTACCTCTCTTATGTTGATACAACAGCAGGTTTTTGATGACAAATAAAATCGATAATAACCAATTACTTCATGATGTGACCCGTTACTGGAATATCCGCGCTGAAAGCTATAGTGCTGCCAACCAGCAAGAGTTATTAAGTGAAAAACAGCAAAAATGGCGTCAGTTATTGTTAAGCCATGTCAAAGAAGGGGAGACATTAAAGGTTCTTGATATCGGTACGGGGCCGGGATTCTTTGCTATTTTATTAGCGTTGTCGGGCCACCAAGTCACTGCAATTGACGCCACGCCAGGGATGTTGCTTGAGGCTAAAAATAACGCCAGCCAACATAATGTTTCTATTAACTTTGTTTGTGGTGATGTGCAAGATCTTCCCTTTGGCGATGAACAATTTGATTTGGTCGTCAGCCGTAATGTGACATGGAATTTAAAATCACCCTGTGAGGCTTATCAAGAGTGGTTTCGCGTATTAAAACCTGGGGGAAGCTTAATTAATTTTGATGCCAATTGGTATTTACATCTGTTTGATGATGAATATTGGCAAGGTTTTCTTGCTGATAGAGAGCGAGCGGCGCAAAAGCAAGTTGCTGATCACTATGTTAATACTGATACAAAAGAGATGGAAAGAATTGCTCGCCAATTACCATTAAGCCAAGTTAAGCGTCCACAGTGGGATATTAATACACTACTAGATATCGGTTTTATTCGTTATAGCGTGGATATTCGTATTGGTGATCACGTTTGGGATGAAGAAGAAAAAATTAATTACGGCTCAACCCCTATGTTTATGATCCATGCTCAGAAAAATAATCGATGAGAATGATAAAAGGAAAATAATGTGAAACCTCTATTTACAGTTATTCCTAC